KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c14920Help
Entry
Cspa_c14920       CDS       T02467                                 

Gene name
hemD
Definition
porphyrin biosynthesis protein HemD (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:csr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630795..1632270
Genome map
AA seq 491 aa AA seqDB search
MSQVYIIGTGPGDEELLTLKAVKALKKCTAVLYDRLVSNNILNYLNENCEVYYCGKEPGA
HSKTQEEINELLVELAKKGHIVGRIKGGDPYVFGRGGEEVLELRKENISFEVVPGVTSPI
AVLNYAGIPITHRGIAQSFHVVTGKSAQDLNVNFKALAGEQGTLVFMMGLSNLDNIISQL
IANGKSPLTPCGVVMRGTSAKQKKVIGTLENISEKVKAANLKSPCIIVVGEVVTLNESLS
WYENKPLFGKNICITRTKKQSENLKEKLVKMGAEVTSFNAIEIESCAEKLDEYLNTIENY
DHIVFTSVNSVEIFFDYLVEKAYDVRRIKAKISAIGRATERALNNRGIVCFAKAKEFVGE
GLVSILKPNLKVNEKLLLPCSAKSRQYIYEELVRTGVEVDRVFIYDTICGKVVNKKSFEE
VDIVFFTSPSTVKNMVDMLGIDEIKKKQVIAIGPKTNEPLIELGIEAYVCKEHSEDGFLK
EIENLLLRERK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtatatataataggaacaggacctggtgacgaagaattattaacattgaaa
gcagtaaaggcacttaagaagtgtacagctgttctttatgatagattagtttcaaataat
atattaaattatttaaatgaaaattgtgaagtttattattgcggaaaagagcctggggct
cattcaaaaactcaagaggaaataaatgaactcttggttgaacttgcaaagaaaggacat
atagttggaagaataaagggtggagacccttatgtttttggaagaggtggagaagaggta
ttagaattaagaaaagaaaatatttcttttgaagttgttccaggggtaacatcgcctatt
gcagtattgaattatgctggaattccaataactcatagaggtattgcacaaagttttcat
gttgtaactggtaaatcagcacaagatttaaatgttaattttaaagctttagctggggaa
caaggaaccttagtttttatgatggggctaagcaatctagataatattattagtcagtta
atagctaatggtaaatcaccattaactccatgtggagttgtaatgcgagggacttcagca
aaacaaaaaaaggtaataggaacattagaaaatatatctgaaaaagttaaagcggcaaat
ttaaaatcaccatgtataatagtggttggagaagttgtaactttaaatgaaagtttaagt
tggtatgaaaataagccactttttggtaaaaatatctgtattacaagaactaaaaagcag
tcagagaatctaaaagagaaattagtaaaaatgggtgcagaagttacaagctttaatgct
atagaaatagaaagctgtgcagaaaagttagatgaatatttaaatacaatagagaattat
gatcatatagtgtttacttcagttaatagtgtggaaatattttttgattatttagttgaa
aaagcgtatgatgtaagaagaattaaggctaagatttctgcaattggccgtgccactgaa
agagccttaaacaatagaggtattgtatgttttgcaaaggctaaagaatttgtaggtgaa
ggcttagtaagtattttgaaacctaacttaaaggtaaatgaaaagttacttttaccatgt
tcagctaagagcagacaatacatatatgaagaattagttagaacaggtgttgaagtagat
agagtatttatttatgatacaatttgtggtaaggtagtaaataaaaaatcttttgaagaa
gttgatatagtattttttacaagtccatctactgtgaaaaatatggttgatatgttagga
atagatgaaataaaaaagaaacaggttatagctataggacctaagacaaatgaaccttta
atagaattaggaatagaggcttatgtatgtaaagaacattctgaagatggttttttaaag
gaaatagaaaacttattattaagagagaggaagtga

DBGET integrated database retrieval system