KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c14990Help
Entry
Cspa_c14990       CDS       T02467                                 

Gene name
xynB2
Definition
endo-1,4-beta-xylanase B (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
csr  Clostridium saccharoperbutylacetonicum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1639845..1640801
Genome map
AA seq 318 aa AA seqDB search
MLRSKVIKMSVGAVALSLFFSMSTSINANAAMSKNKFIGNIIGNSVPSNFTTYWNQVTPE
NATKWESVESTRDRMNWSGADTDYNYAKSKGLKFKFHTLVWGAQAPKWITSLSAADQKAE
ISEWIQAAGQKYSGSEFVDVVNEPLHTKIDFKNAIGGDGATGWDWVVWSFEQARKAFPNS
KLLINEYGIIGNPSEADKYVKIINILKSRGLIDGIGIQCHQFNMDTVSVSTMNNVLNKLS
ATGLPIYVSELDITGDDATQLARYKEKFPVLWENPNIKGVTLWGYIQGQTWKSNTHLINS
NGTERPALKWLKSYLASH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttaagatcaaaagttatcaaaatgtctgtaggagcagttgcacttagtttatttttt
tcaatgtctacttctataaatgcaaatgctgcaatgtctaaaaataagtttataggaaac
ataattggaaatagtgttccgtctaatttcacaacttactggaatcaagtaacaccagaa
aatgccactaagtgggaatcggttgaatcaaccagagataggatgaactggtctggtgca
gatactgattacaattatgcaaaaagcaaggggttaaaatttaaattccatacattagtg
tggggagctcaagcaccaaaatggataacaagtctttcagcggcagatcaaaaagcagag
atatctgagtggattcaagctgcaggtcaaaagtattcgggttcagagtttgtagatgtt
gtaaatgaaccgttgcatactaaaatagattttaagaatgctataggtggagatggtgca
acaggctgggattgggttgtttggtcctttgaacaagcaagaaaggcatttcctaattca
aaattactaattaatgaatatggtatcattggaaaccctagtgaagccgataagtatgta
aaaattataaatatacttaagagcagaggtcttatcgatggaataggtattcaatgtcat
caatttaatatggatacggtttctgtaagcacaatgaataatgttttaaacaaattatca
gcaactggtttgccaatatatgtatcagaacttgatataactggtgatgatgcaacacaa
ttagcaagatataaggaaaaattcccagtattatgggaaaaccctaatattaaaggcgta
accttatggggatatatccaagggcaaacatggaaaagtaatactcatttgattaattca
aatggaactgaacgtccagcacttaaatggttaaaatcatatttagcaagtcattaa

DBGET integrated database retrieval system