KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c15030Help
Entry
Cspa_c15030       CDS       T02467                                 

Gene name
xynA1
Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
csr  Clostridium saccharoperbutylacetonicum
Brite
Enzymes [BR:csr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cspa_c15030 (xynA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1643989..1645194
Genome map
AA seq 401 aa AA seqDB search
MKKYLSVILSATLMMSTFLTSGIQVNAATTTNVAASVPSNANLLNTYGKVFGKVGNILNG
GQISDSNATNAIKKQYNSLTAENEMKPDGILGSSANVISISQAKALGYYIPDNYPESTVP
KLNFATVDNMLKFCYDNGLSMRGHTLVWHSQTPDWYFRTGYNGNGGYVTPAVMDKRMEFY
IKSVMGHVFSSKYGSVIYAWDVVNEYLHAEPAGSSKATGWQKIYGNLGTKPGFVKQAFQY
AYDTLAYYKLTDKVKLFYNDYNEYMEVNDIISLINYINSGKKICAGIGMQSHLSTNFPSV
AYYKNALDAFAKAGFEIQITELDVGSTSSSEQSKYYYDLMTAILSSKKSGANITALVWWG
LSDDHSWRSKDKPLLYSNYSTPKEAYNSVLKAYFDAGYTMK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatctaagcgtaattttgtcagcaactcttatgatgtctacatttcttact
tcgggaattcaagtaaatgcagcaacaacaactaatgtagcagcatctgtcccaagtaat
gccaatttattaaacacttatggtaaagtgtttggaaaggtaggaaatatattaaatgga
ggtcaaatttcagatagtaacgcaacaaatgctataaagaagcaatacaatagtttaact
gcagaaaatgaaatgaaacctgatggtattttaggttcctctgcaaatgtgatttctata
tcacaagcaaaagcacttgggtactatattcctgataattatccagaaagtacagttcca
aaacttaattttgcaactgtagataatatgttgaaattttgttatgacaatggattatca
atgcgtggtcatacactagtttggcattcacaaactccagattggtatttcagaacaggc
tataacggtaatggaggatatgtaactccagcagttatggataagagaatggaattctat
attaagagtgttatgggacatgttttttcaagtaaatatggaagcgttatttatgcatgg
gatgttgtgaatgaatacttacatgcagaacctgctggaagttctaaagctactggatgg
caaaagatttatggaaatcttgggacaaaaccaggttttgtaaaacaagcttttcaatat
gcatatgatacattagcatattataaattaacagataaagttaaattattctataatgat
tataacgaatatatggaagtaaatgatattatcagtttgattaattacattaattcaggc
aaaaaaatatgtgcaggaataggtatgcaatctcatttaagtactaatttcccatcagtt
gcttattataaaaatgcattagatgcatttgcaaaagcaggctttgaaattcaaattaca
gaacttgatgttggatctacttcttcatcagaacaatcaaaatactattatgatttaatg
actgctattttatcttctaaaaaatcaggtgctaatattacagctcttgtatggtgggga
ttaagtgatgatcattcatggcgttctaaagataaaccattattatattctaattattca
acaccaaaagaagcatataattcagtattaaaagcatattttgatgctggatatactatg
aaataa

DBGET integrated database retrieval system