KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c15090Help
Entry
Cspa_c15090       CDS       T02467                                 

Gene name
engD2
Definition
endoglucanase D (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cspa_c15090 (engD2)
Enzymes [BR:csr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cspa_c15090 (engD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1651031..1652167)
Genome map
AA seq 378 aa AA seqDB search
MIIRKKSLILALTFSTLALFSAIPASASTAYTGMRDVTAQQIVDDMKIGWNLGNTLDAYS
TSTSNSLSSEISWGNPKTTHAMIDRIKAAGFNTVRIPTTWYNHMGSSPNYTIDSAWFDRV
EEVMNYAFDNDMYVILNMHHEDSWLIPTYEKQEQVKAQLTKAWAQIANRFNKYGDHLIFE
TMNEPRPVGASNEWTGGSHENREVINNYNLAAVNTIRNTGGNNKTRCIMVPTLAASTTSV
AVNDYVIPNNDKRIIISLHMYSPYFFAMDQAGTANWGTATDKSELDSEFDAIANKFVKSG
HPVVIGEFGTINKNNNSARAIHAEYYVKAAKSRHITPVWWDNGYSTAGKSDTYGLLNRNT
LNLDCPEVVSALMKGANK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgattattagaaaaaaatcattaattttagcacttactttttctacacttgcccttttt
agtgcaattccagcttcagcatctactgcttacactggaatgcgcgatgttacagcacaa
caaattgttgacgatatgaaaattggatggaatttaggaaatacccttgatgcttatagc
acttcaacatctaattcactttcctccgaaataagttggggaaatcctaaaactactcat
gctatgattgataggatcaaagcggcaggatttaatactgttagaattccgacaacgtgg
tataaccatatgggatcttcacctaattacacaattgattcagcatggtttgacagagtt
gaagaagttatgaattacgcttttgataacgatatgtacgttattcttaatatgcatcat
gaagactcttggttaataccaacttatgaaaaacaggaacaagtaaaagctcaactaact
aaggcatgggcacaaattgcaaatagatttaataaatatggtgaccatttaatttttgaa
acaatgaatgaaccgaggccagttggagcatctaacgaatggacaggtggctcccatgaa
aatcgtgaagtaattaataactataacctagctgctgtaaatacaatcaggaacactggt
ggaaacaataaaactagatgtattatggtgcctacacttgctgcatcaacaacttctgta
gcagttaatgattatgttattccaaataatgataagagaattataatatcattacacatg
tactcaccttatttcttcgccatggatcaagctggtacagctaattggggaactgccaca
gacaaaagtgaattagattctgaatttgatgcaattgctaataaattcgtaaaaagtgga
catcctgtagttattggtgaatttggtacaattaataaaaacaataactcagctagggca
atccatgctgaatattatgttaaagcagcaaaatctagacatattactcctgtttggtgg
gataatggatactctacagctgggaaatcagacacctatggtttattaaatagaaataca
ttaaatttagattgcccagaagtagtttctgctcttatgaaaggtgctaataaataa

DBGET integrated database retrieval system