KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c17560Help
Entry
Cspa_c17560       CDS       T02467                                 

Gene name
gtfA1
Definition
sucrose phosphorylase GtfA (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cspa_c17560 (gtfA1)
Enzymes [BR:csr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Cspa_c17560 (gtfA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1937782..1939251
Genome map
AA seq 489 aa AA seqDB search
MAVKNKVQLITYPDSLGGDLKTLNNVLLKYFSDIFEGGIHILPPFPSSGDRGFAPLTYLE
IEPSFGTWEDIKAIGENFDILVDLMVNHISKKSKYFQDFIKKGRNSEYADLFITLDKIWE
DGKPKQEDIEKMFLRRKLPYSTFTVEETGEEEKVWTTFGKTDPSEQIDLYIKSQKAKDLL
KEFFMNFKKQNVKIVRLDAVGYVIKKLGTSCFFVEPEIYDFLDWIKELADSLEIELLPEV
HSHYSIQYKLADHGFWIYDFILPYTILDTLINKSSEKLCEYLKVRPKKQFTMLDCHDGIP
VKPDMDDLIDTKEARKLVDVCVERGSNLSLILSEEHKAEDGFDVHQIRCSYYSVLNCDDD
AYLAARAIQFFTPGIPQVYYVGALAGENDTENVKKTGEGREINRHNFSIEEIEQSLKKDV
VQRLLKLIKFRNEYDAFNGEFKVLDCAKDEIKLIWEKDSKFCELFIDIKTNESVINYIDE
VGNLAKYKI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcggttaaaaataaagtacagcttataacttaccccgattctcttggaggcgactta
aaaacacttaataatgtacttttaaaatacttctctgatatatttgaaggtggaatacat
atactccctccatttccctcatctggagatagaggttttgctccattaacctatttagaa
attgagccaagctttggtacctgggaggatataaaagctataggagaaaactttgatatt
ttagtagatttaatggttaatcacatttctaagaagtctaaatattttcaggattttatt
aaaaaaggacgaaattcagaatatgcagacttgtttataaccttagacaaaatttgggaa
gatggaaaaccaaaacaagaagatattgaaaaaatgtttttacgtagaaaattaccatat
tcaacttttactgtggaagagactggtgaagaagagaaggtatggactacatttggtaag
acagatccttctgaacaaattgatttatatataaaatctcaaaaagcaaaagatcttctt
aaagaattttttatgaactttaagaagcaaaatgttaaaatagtaagattagatgcagtg
gggtatgttattaaaaaacttggaacaagctgcttctttgtagagccagaaatatatgac
ttccttgattggattaaagaactggcagattcattggaaattgaattgctgcctgaagtt
cattcacactattcaattcaatataaactagcagatcacggattttggatatacgatttt
attttaccttatactattttagatacgttaataaataagtctagtgagaaactttgtgag
taccttaaagtacgtcctaaaaaacagtttacaatgcttgactgtcatgatggaattcca
gttaagccagatatggatgatcttatagataccaaggaggcaagaaaattagttgatgta
tgtgtagaaagaggttcaaatcttagcctcattttatcagaggaacacaaggctgaggat
ggttttgatgtacatcaaataagatgttcttactattcagtacttaattgtgatgatgat
gcatacttagcagctagagcaattcaattttttacacctggaataccacaagtatattat
gtaggagcattagcaggagaaaatgacactgaaaatgtaaagaaaaccggtgaaggtcgt
gaaatcaatcgtcataattttagtattgaggaaattgaacagtcccttaaaaaagatgta
gttcaaagacttttaaagctaataaaattcagaaatgagtatgatgcttttaatggagaa
tttaaggttttagattgtgctaaagatgaaattaaacttatttgggaaaaggactctaaa
ttttgtgaattatttatagatattaaaaccaatgagagtgttataaactatattgatgaa
gtgggtaatttggctaaatataagatataa

DBGET integrated database retrieval system