KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c23080Help
Entry
Cspa_c23080       CDS       T02467                                 

Gene name
agaR2
Definition
alpha-galactosidase 1 (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cspa_c23080 (agaR2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cspa_c23080 (agaR2)
   00600 Sphingolipid metabolism
    Cspa_c23080 (agaR2)
Enzymes [BR:csr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Cspa_c23080 (agaR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2539954..2542161
Genome map
AA seq 735 aa AA seqDB search
MAIKYSEKSREFHLYNKEISYIIKILDNNQLGNLYYGKRIHHKESFSYLLEGGMRPLAAY
VFEGDTNFSLQHTRQEYPSYGTTDFRYPAFEIKQKNGSKITCFEFEAYNIFKGKKKLEKL
PATYVENEIEAQTLEIILYDKLIKTRLVLSYTIYKDLPVIARNAKFLHEGKEEIVLTKAM
SCSLDLPDYDYEMVHLAGAWSRERHVKIKSLEQGVQSIYSLRGTSSAEHNPFIALKRPNT
TEFEGEVYGLSLVYSGNFLGEVLVDTHGTSRIMLGIHPNMFEWRLKENERFQTPEVVMVY
SDKGLNGMSQVYHKLYRSRLARGFWRDKVRPILINNWEATSFDFNEERILKIAKAAKDLG
IELFVLDDGWFGERNNDKAGLGDWYVNTKKLPAGIVGLSKKIEEIGMKFGLWFEPEMVNK
DSKLYRSHPDWIIHTPNRTASHCRNQYILDFSRKEVIDYIYEAMSKVLREASISYVKWDM
NRYMTECYSVVKIAENQGKVMHEYILGVYSLYEKLTSEFPYILFESCSSGGARFDPGILY
YAPQGWTSDNTDAVERMKIQYGTSFVYPISSMGAHVSEVPNQQVFRTTPLETRAKVAYFG
AFGYELDLNNLSKKEREIVKRQVEFMKAKRELIQKGIFYRLVSPFENNINSWMVVAEDKS
EAVVGYYKILNTANDGFKRIKLQGLDSNKKYYINEDKQNAFFGDELMFAGIPVKQEELCN
NGGDFSSIIYYLKEE
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaatacagcgaaaaatctagagaatttcatttatataataaagaaataagc
tatattataaaaatattagataataaccaattgggaaatttgtattatggaaaaagaatt
catcataaagaatctttttcatatcttttagaagggggaatgcgtccattagcagcatat
gtatttgaaggtgatactaacttttcacttcaacatacaagacaagaatatccctcttat
ggtacaacagactttagatatcctgcctttgaaataaagcagaagaatggaagtaagata
acttgttttgaatttgaggcatataacatttttaaaggtaaaaagaagctggagaaactt
cctgcgacttacgttgaaaatgaaattgaagcacaaaccttagaaataatattgtacgat
aagcttataaaaacaagattagttttaagttatactatttacaaggatttacctgttata
gcaaggaatgcgaaatttctgcatgaaggaaaagaagaaattgttttgacaaaagcgatg
agctgcagtttagatctgccagattatgattatgaaatggtacatttagcgggagcttgg
agtagggaaagacatgtgaaaattaaaagtttagaacaaggagttcaatcaatttatagc
ttaagaggtacaagtagcgcagaacataatccttttatagcattaaaaagaccaaataca
actgaatttgaaggtgaagtttatggccttagcttagtttatagtggtaattttttaggc
gaagtattggtagatactcatggcacctcaagaattatgttaggaattcatcctaatatg
tttgaatggagattaaaggaaaatgaaagatttcaaacgccagaagttgtaatggtttat
tcagataaaggcttaaatggaatgagtcaagtttaccataaattatatagatcaagacta
gcaaggggattttggagagataaggtgcgtccaatcttaataaataactgggaagctacg
tcctttgattttaatgaggaaagaatacttaagattgctaaagctgcaaaagaccttgga
atagagttatttgtattagatgatggatggtttggagagcgtaataatgataaagctggt
ctaggagattggtatgtaaatactaaaaaacttcctgctggaatagttggactttcaaag
aaaattgaagaaataggaatgaagttcgggctttggtttgagcctgagatggttaataaa
gatagtaagttatatagaagtcatcctgattggattattcatacaccaaatagaacagca
tctcattgtagaaatcaatatatattagatttttctagaaaagaagtaattgattatata
tatgaagctatgtcaaaggtattgcgtgaagcgtcaatatcatatgtaaaatgggatatg
aatagatatatgactgaatgttacagcgttgttaaaatagcagaaaatcaaggcaaagta
atgcatgaatatattttaggggtgtattccttatatgaaaaattaacctctgaattccca
tatattttatttgagtcatgttcaagtggtggtgcaagatttgatccaggaatactttat
tatgcgccacaaggctggacaagtgataatacagatgcagttgaaaggatgaaaatacaa
tatggaacttcttttgtatatccaataagtagcatgggagcacatgtatctgaagtgcca
aatcagcaggtgtttagaacaactccccttgaaactagagcaaaggtagcatactttggt
gcttttggatatgagttggatttgaataatttatcaaagaaagaaagagaaatagtaaaa
aggcaagttgaatttatgaaagctaagagggaactaattcaaaaaggaattttttataga
ttggtaagtccttttgaaaacaatataaattcttggatggttgtggcagaagataaatct
gaagcagtagtagggtattataaaatactgaatacagcaaatgacgggtttaagagaatt
aaattgcaagggttagattcaaacaaaaaatattatattaatgaagataaacaaaatgca
ttttttggcgatgaattgatgtttgcaggaataccagtaaagcaagaagagctttgtaac
aatggtggagatttttcatcaattatatattatttaaaagaagaataa

DBGET integrated database retrieval system