KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c28480Help
Entry
Cspa_c28480       CDS       T02467                                 

Definition
esterase/lipase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
csr  Clostridium saccharoperbutylacetonicum
Brite
Enzymes [BR:csr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Cspa_c28480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3081947..3082678)
Genome map
AA seq 243 aa AA seqDB search
MENINLKDEYFIKGNDVGCLLIHGFTSTPAELRELGENLIGEGYTVYGMRLAGHGTTVED
FEISTHAHWISSVVQAYNKLKTSCSKIYVIGHSMGGVLSLILGENYHVDKLVLLAPALMT
KDKRAMFIPLLKHFMKYTEWPPSERPEEESKYLLGYNKIPLSCVHELSKLQKIARTDLNK
IAKPLLIIHSEKDNSINEKGVEVIKENVTSKQIKDVCLRKCGHNITIECEKEAVFEEVVK
FLK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatataaaccttaaagatgaatattttattaaaggaaatgatgttggatgcctg
ctaatacacggattcacctcaacgccagctgaattaagggaattaggtgaaaatcttata
ggtgaaggctataccgtttatggtatgaggcttgcaggtcatggtacaactgtagaggat
tttgaaatttcaacacatgctcattggataagttctgttgttcaagcctataataagctc
aagacttcttgcagtaaaatatatgtaattggccattctatgggaggtgttttatcttta
atccttggtgaaaactaccatgttgataagcttgtattgttagcaccggctctaatgact
aaagataaaagagctatgtttattccattattaaaacattttatgaaatatactgaatgg
cctccaagtgaacgccctgaagaggaatcaaaatatttattaggttacaataaaatacca
ttatcctgtgttcatgaattaagtaaacttcaaaaaatcgcacgaactgatttaaataag
atcgctaagcctttgctaataattcattcagaaaaggataattcaattaatgaaaaaggc
gttgaagtaataaaggaaaatgtaacttcaaaacaaattaaagatgtatgtctaagaaaa
tgtggacataatataacaatagaatgtgaaaaagaagcagtatttgaggaagtagtcaaa
tttcttaaatag

DBGET integrated database retrieval system