KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c37180Help
Entry
Cspa_c37180       CDS       T02467                                 

Gene name
adhE2
Definition
aldehyde-alcohol dehydrogenase AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cspa_c37180 (adhE2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cspa_c37180 (adhE2)
   00620 Pyruvate metabolism
    Cspa_c37180 (adhE2)
   00650 Butanoate metabolism
    Cspa_c37180 (adhE2)
  Lipid metabolism
   00071 Fatty acid degradation
    Cspa_c37180 (adhE2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cspa_c37180 (adhE2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cspa_c37180 (adhE2)
   00626 Naphthalene degradation
    Cspa_c37180 (adhE2)
Enzymes [BR:csr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cspa_c37180 (adhE2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cspa_c37180 (adhE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4020656..4023244)
Genome map
AA seq 862 aa AA seqDB search
MKVTNIEELMKKLEEVRNAQKEFSTFTQEQVDEIFREAAIEVAHHRISLAKMAVEETGMG
IIEDKVIKNHFASEYIYNKYKDEKTCGVIESDEAFGMTKVAEPIGVVAAVIPTTNPTSTA
IFKSLISLKTRNGIILSPHPRAKNCTIAAAKIVLNAAVKAGAPKGIIGWIDEPSVELSQE
LMREADITLATGGPSMVKAAYSSGKPALGVGPGNTPVIIDESAHIKMAVNSILLSKTFDN
GVICASEQSIIALDSIYNEVRREFKERGAYILNPEEADKVRKAIFIDGSINGKIVGQSAY
KIAEMAGIKVPETVKVLIGEVESLGEEEPFAHEKLSPVLAMYRAKNFDNAIEKAKVLLEL
GGLGHTSVLYVNSITGRDKIAKFGGAMKTVRTFINIPASHGANGDLYNFKIAPSFTLGCG
SWGGNSVSENVGPKHLLNIKSVAERRENMLWFKVPKKIYFKFGCLGFALRELKEMNRKKA
FIVTDKILEELGYVDNVTKVLEEIGISFRVFSEVEPDPTLSTAKKGVAEMLSFNPDTIIS
IGGGSPMDAAKIMWVLYEHPEEKFEDLAMRFMDIRKRLYPFPKLGEKAMMVSIPTSAGTG
SEVTPFAVITNEKSGIKYPLADYELTPDMAIVDAELMMNMPKSLTASSGIDALIHGIEAY
TSVLASEYTNGLALEAIRLIFKYLPEAYEDGATNVKAREKMAHASTTAGMAFANAFLGVC
HSMAHKLGAEHHIPHGIANALLIDEAIRFNAVDNPLKQTAYPQYKYPNVKSRYARIADYL
NLGGNSEEEKVELLIKAIDELKERLNLPKTIKEAGVSEKKFYATLDEMSEQAFDDQCTGA
NPRYPLISEIKQMFINVFDKAE
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgacaaatatcgaagaattaatgaaaaaattagaagaagtaagaaatgctcaa
aaggagttttctactttcactcaggagcaagtagatgagatttttagagaagccgctatc
gaagttgctcatcatagaatcagcttagctaaaatggctgtagaagagactggtatggga
attatagaggacaaggttattaaaaatcattttgcatcagagtatatatacaataagtac
aaggatgagaagacttgtggagttatagaaagcgatgaagcctttggtatgactaaggtt
gcagaaccaataggagttgttgcagctgttatacctacaactaatccaacctcaacagca
atattcaaatcattgatatcattaaaaactagaaacggtataattttatcaccacatcca
agagcaaagaactgtactatagcagcagctaaaatagttcttaatgcggcagtgaaagca
ggagctccgaaaggaattattggatggatagatgaaccttcagttgaactttcacaagag
ttaatgagagaggcagatataactttagcaactggcggaccatcaatggttaaagcggcc
tattcatcagggaaaccagcactaggtgttggaccaggtaatactccggttataattgat
gaatctgctcacattaaaatggctgtaaattcaatacttctttcaaaaacatttgataac
ggagttatatgtgcatcagaacaatcaataatagcattagattcaatatataacgaagtt
agaagagaatttaaagaaagaggagcatatatacttaatcctgaggaagcagataaagtt
agaaaagcaatatttatagacggaagcataaatggaaaaattgtaggtcaatcagcttat
aaaatagctgaaatggcaggaattaaagttccggagacagtaaaagttttaatcggagaa
gttgaatctttaggagaggaagaaccatttgcacatgaaaaattatctccagtacttgca
atgtatagggcaaagaattttgataatgccatagaaaaagcaaaagtactactagaattg
ggcggacttggacatacatctgtattgtatgtaaattcaataacaggtagggataaaata
gctaagtttggtggagccatgaagactgtaagaacatttataaacatacctgcatcacat
ggggcaaatggagatttatataattttaaaatagctccttcatttacattaggttgcggt
tcatggggcggaaattctgtttcagaaaatgttggacctaaacatcttttaaatattaaa
agtgtagctgagaggagagaaaatatgctttggtttaaagttcctaaaaaaatttacttc
aaatttggatgtcttggatttgcactaagagaattaaaagaaatgaatagaaaaaaagct
tttatagttactgataaaatattagaggaactaggatatgttgataatgttacaaaagtt
ttagaagaaataggaattagctttagagtgttttcagaagtagaacctgatccgacttta
tccacagctaaaaaaggtgtagctgaaatgttgagcttcaatccagacacaattatatcc
attggtggtggatcaccaatggatgctgccaaaatcatgtgggtattgtatgaacatcca
gaagaaaagttcgaagaccttgctatgagatttatggatataagaaagagattgtatcca
ttcccgaaactaggagaaaaggcaatgatggtatcaataccaacatcagcaggtacaggt
tcagaagttactccatttgcagttataacaaatgagaaatcaggaatcaaatatccgctt
gctgattatgaattaacaccggatatggcaatcgttgatgcagagttaatgatgaatatg
ccaaaaagtttaacagcttcttctggaatagatgcgttgattcatggtatagaagcatat
acatcagtacttgcgtcagaatatactaatggactagcactagaagccataagattaata
tttaaatatttacctgaagcatatgaggatggagcgactaacgtaaaggcaagagaaaaa
atggctcatgcatcaacaacagcaggtatggcttttgctaatgcattcttaggtgtatgt
cactctatggcacataaactaggggcagaacatcatatacctcatggaattgctaatgca
ttattaatagatgaagctataagatttaatgcggtggacaacccattaaaacaaacagca
tatccgcaatataaatatccaaatgtaaagagcagatatgctagaattgcagattacttg
aacttaggaggaaattcagaagaagaaaaagtagaattattaatcaaagctatagatgaa
ttaaaagaaaggctaaacttaccaaagacaattaaagaagcaggggtttcagaaaagaaa
ttctatgcaactcttgatgaaatgtcagaacaagcctttgatgatcaatgtactggggca
aatccaagatatccattgataagcgaaatcaagcaaatgttcataaatgtttttgataaa
gctgaataa

DBGET integrated database retrieval system