KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c39710Help
Entry
Cspa_c39710       CDS       T02467                                 

Gene name
rbsK
Definition
ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cspa_c39710 (rbsK)
Enzymes [BR:csr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cspa_c39710 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4301058..4301960)
Genome map
AA seq 300 aa AA seqDB search
MKVLSFGSLNIDYVYSVEHFMKPGETQASHSLDIFCGGKGLNQSIALSRSKAQVYHAGAV
GESDSAMLINALESAGVNTKYIKRVKGNSGHAIIQKDITGQNSILLFGGANQQISVEYIK
EVLSNFENGDFIILQNEISCIKEIMEEAYVRGLKIVFNPSPMNSEVLKYPLNNVEYFILN
EVEAREIIESEEDGEELIKAVANKFPNAKIILTLGEKGAFYRFKDIQLKHNSYSVEVTDT
TAAGDTFLGYFIGSIAKEYGVEEALELASKAAAISVTRLGASTSIPELDEVINNKFIEKA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttcttagttttggatccttgaatatagattatgtttacagtgttgaacacttt
atgaaaccaggagaaacacaagcctcacatagcttggatatattttgtggcggcaagggc
ttaaatcagtcaattgcattaagtcgaagtaaagcacaagtgtatcatgctggagctgtt
ggagaatcagattcagccatgcttattaatgctttagagtcagctggtgtaaatactaaa
tatattaaaagggttaaagggaattcaggacatgcaattattcaaaaagatattactgga
caaaatagtatattattatttggaggggctaatcaacaaatatcagtagagtatattaaa
gaggttttatctaattttgaaaatggggattttattatattacaaaatgagatttcctgt
attaaagaaattatggaagaagcttatgtaagaggtttgaaaattgtatttaatccatca
ccaatgaattccgaggttttaaaatatcctttaaataatgtagaatattttattttaaat
gaagttgaagcaagagagataattgagtcggaagaagatggagaagaattaattaaggca
gtggctaataaatttccaaatgcaaaaattattttaactttaggcgaaaaaggtgctttt
taccgctttaaggatatacaattgaaacataatagctatagtgttgaggttacagatact
actgcagctggtgatacatttctaggttattttattggaagtattgcaaaggaatatggg
gtagaagaagcattggaactagcatccaaagcagcagctatatcagtcacacgcttagga
gcatcaacatcaattccagaattagatgaagtgataaataataaatttattgagaaagct
taa

DBGET integrated database retrieval system