KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c42780Help
Entry
Cspa_c42780       CDS       T02467                                 

Gene name
pemA1
Definition
pectinesterase A (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:csr00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4631294..4632259
Genome map
AA seq 321 aa AA seqDB search
MIIVSKDGNGQFKTIQAAIDSIPENNSEEVEIYIKNGVYKEKISILKPYITLIGEDNEKT
ILTFDDYAKKLFPNGEAYRTFNTYTIFIRANDFTAKNLTIENSAGQGEIVGQAVAVYVEG
DKSIFKDCRFLANQDTLFTGPLPPKPIEGNNFGGPMEGKERTVGRQYYENCYIEGDIDFI
FGSATAVFNKCEIFSKDINSEVNGYATAASTVQGREFGYVFFDCKLTSNAPAHTVYLGRP
WRDYAKTVFINCFIGEHIKKEGWHSWDKPLAEKETYYAEYKSYGPGASDTTRVSWSHILT
DEEVNKYTISNILGGNDNWLS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataatagtttcaaaagatggaaatggacaatttaaaactattcaagcagcaattgat
tcgattcctgaaaacaattctgaagaagttgaaatatacattaaaaatggagtctacaaa
gaaaaaatatctatattgaagccatatattacacttattggtgaagataatgaaaaaact
attttaacatttgatgattatgctaaaaaattatttccaaatggtgaagcataccgaact
tttaacacttatactatttttataagagctaatgactttactgcaaaaaacctaacaatc
gaaaattcagcaggtcaaggagaaattgttggacaagctgttgctgtgtatgttgaagga
gataaatcaatatttaaagactgtagatttctagctaatcaagataccttatttactggt
cctcttccaccaaaacctatagaaggcaataatttcggtggaccaatggaaggaaaagaa
cgaaccgtaggtagacaatattatgaaaattgttatatcgaaggtgatatcgattttatt
tttggttctgctacagctgtatttaataaatgtgaaatattttcaaaggatataaattct
gaagtaaacggctatgcaactgctgcttcaaccgttcaaggcagagaatttggttatgtc
ttctttgattgtaaattaactagtaacgcacctgctcatactgtttacctaggaaggcct
tggagagattatgcaaaaacagtttttataaactgctttattggagaacatataaaaaaa
gaaggctggcatagctgggataagccacttgctgaaaaagaaacttattatgctgaatat
aaaagctacggccctggcgcttctgatacaacaagagtttcatggtctcacattttaact
gatgaggaagtaaataaatatacgatttccaatatattaggtggaaatgataattggtta
agctag

DBGET integrated database retrieval system