KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c47620Help
Entry
Cspa_c47620       CDS       T02467                                 

Gene name
ulaF2
Definition
L-ribulose-5-phosphate 4-epimerase UlaF (EC:5.1.3.4)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cspa_c47620 (ulaF2)
Enzymes [BR:csr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Cspa_c47620 (ulaF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5211327..5211962)
Genome map
AA seq 211 aa AA seqDB search
MKYEKIRKQVLEAILDAVDMGLIKGTSGNIAVRDEEEDVVAITPSGIAYKTMKAEDIAIV
DLNGKWLDGPYKPSSEVPMHTAILRARPDIKATVHTHGMFATIAAMEGELLPTTPPQAEF
VPINIVPFTMPGSNDLADLVVKTLGDGRAALMKNHGMICCGKNIKAAMAATIYTEEMATT
QYYAKSAGIFKPLPEEAVQKMKELIAADQAV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaaaaaattagaaaacaagtactagaggcaattttagatgcggttgatatg
ggattaattaagggtacatcaggaaatattgcagtaagagatgaagaagaagatgttgtt
gcaattactccaagtggaattgcatacaaaacaatgaaagcagaagacattgcaattgta
gatttaaatggaaaatggttagatggaccatataaaccttcatcagaagttccaatgcat
actgcaattcttagagcaagaccagacattaaagcaacagttcatacacatggtatgttt
gcaacaatagcagctatggagggtgaattactgccaacaacaccaccacaagctgaattt
gtaccaattaatattgttccatttactatgccaggaagtaatgatcttgcagatttagta
gtaaaaacattaggcgatggaagagctgcattaatgaaaaatcatggaatgatttgttgt
ggaaaaaatattaaagcagcaatggcagccactatttatacagaagaaatggcaactact
caatattatgcaaaatcagctggaatattcaaaccacttccagaagaagcagtacaaaaa
atgaaagagttgattgcggcagatcaagctgtatag

DBGET integrated database retrieval system