KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c53120Help
Entry
Cspa_c53120       CDS       T02467                                 

Gene name
pemA2
Definition
pectinesterase A (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cspa_c53120 (pemA2)
   00500 Starch and sucrose metabolism
    Cspa_c53120 (pemA2)
Enzymes [BR:csr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Cspa_c53120 (pemA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5890365..5891450)
Genome map
AA seq 361 aa AA seqDB search
MKKSRLNKSIAAFMLGFVIIGTVIGSKQITFAATNSKAAANAATNYDVVVAKDGSGNFKT
ITDAYNYLIRSNSGSTRKTIYVKNGVYKEQLTISRSSITIIGESKNNTILTYNVANGDPK
PTGGTYNSADCAALTVAANDFNAENITFENSHLKDTGKDVQASCIYTYGDRITFTNCNFY
SGQDTLCAYTYGANKSRAYFKNCFIQGSVDFIWGGATALFENCTLNDIRDGGMYTAANTP
KGQKFGYVFLNCTLTANEDVNYTFKTNPRWKTPSTVYLGRTYGDYCHVSYINCNLNAPVN
SAGWLKMNNNVNNTALLEEYGCKGTGANRSKRVSWSKAITSNEASKYTKANILSGNDGWK
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtagattaaataaatcaattgcagcgtttatgttaggctttgtaattatt
ggaacggttattggatcaaaacaaattactttcgcagcaactaatagcaaagctgctgct
aatgcagcaacaaattatgatgttgttgttgctaaagatggtagtggaaattttaaaaca
atcacagatgcttataactatttgatacgttccaatagtggatctacgagaaaaaccata
tacgttaaaaatggtgtttataaagaacaacttaccatttcaagatcttctataactata
atcggtgaaagtaaaaataatacaatacttacctataatgttgcaaatggagatcctaaa
cctactgggggtacttataactcagcagattgtgcagctttaactgttgctgcaaatgac
tttaatgcagaaaatattacttttgaaaacagtcatttaaaggatactggtaaagatgtt
caggcatcttgtatttatacttatggagatagaattactttcactaattgtaatttttat
agtgggcaagataccttatgtgcatatacctatggtgcaaataaatctagagcttatttt
aagaattgttttatacaaggtagcgttgactttatttggggaggtgctactgcattattt
gagaattgtacattaaatgatataagagatggggggatgtatacagctgctaacactcct
aaaggtcagaaatttggatatgtatttttaaattgcactttaaccgctaatgaagatgtt
aattacacattcaaaactaatcctcgttggaaaacaccttcaacagtttatcttggaaga
acttatggggactactgtcacgtatcatatataaattgtaatctaaatgcaccagttaac
tcagcaggttggctaaagatgaacaataatgtaaataatactgctcttttagaggaatat
ggatgcaaaggtactggtgctaatagatctaagagagtatcctggtcaaaagctattact
agcaatgaagcgtctaagtatacaaaggctaatattttatcaggaaatgacggttggaaa
ccataa

DBGET integrated database retrieval system