KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c55830Help
Entry
Cspa_c55830       CDS       T02467                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme GlgB 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6246375..6248894)
Genome map
AA seq 839 aa AA seqDB search
MRKDSKNSKSENEVIVSSIIDKSEEKVIKGLTKKDIADGQNAIKTKQSSQKKVLSTEETK
IEPGIKEKEISVLEDDKDLKEKTKVTAKKTTAKRSTAVKSSSRSQKTQDSASKTQGDRTN
KLSATDENTEEKIVASKTKKTATSTKSTTTRKAVAKKTIAAKAEGKQISKEVKSQMKKQP
ARNTNKKVDDKLDKSELTSFNTYLFHQGNNYEAYNIFGAHAKTENGKKGVQFATWAPNAK
GVYVVGDFNEFEVSEEFKLEKITENGIWKGFFTEPKVGDRYKYCVIEESGERGEYKADPY
AIQTELRPNNASIIYTPKEFKWTDEKWIVKRNKINVLEQPINIYEIHLGSWKTNSEGGFL
TYEQITKELPKYLKEMSYTHVEIMPLVEHPLDASWGYQGTGYYSPTSRYGNLEGLKKLIN
KLHEENIGVIMDWVPGHFCKDSHGLYKFDGTPTYEYQDEWRAENKGWGTCNFDLGRTEVK
SYLISNALYWFREFHIDGLRVDAVSSILYLDYSRSHGEWVPNKYGGNGNLEAIDFLKQLN
KAVFTEYPTALMIAEESTAWPNVTKPTIYDGLGFNFKWNMGWMNDTLEYVQIDPEYRKHN
HKNITFAMMYNYAENYLLPLSHDEVVHGKKSLIDKMWGDEWNRFAGLRAFIGYMMGHPGK
KLLFMGSEFAQEVEWREYSQLDWNLLDDLEIHKKTQLFFKDLNKLYLNNKAFWELDHDYK
GFNWIEADNNEQSILIFARRSRSDEDTLLFVINFTSTVYYDYRIGVPFLGSYEEIFNTDD
TKYGGSGQIMDETLIAEKVQFHKQPYSLQIKVPPMAALVLKVKEIKMEIGTDEEVIEEI
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagattctaaaaatagtaagagtgaaaatgaagttattgtttcaagtattata
gataaatcagaagagaaagttataaaaggtcttactaaaaaagacattgcagatggtcaa
aatgctataaaaactaagcaaagttctcaaaagaaagttttatcaactgaagaaactaaa
atagaaccgggtattaaagaaaaggaaattagcgtattagaagatgacaaggatttaaaa
gagaaaactaaggttactgctaaaaaaacaactgccaaaagaagtactgctgttaaatct
tcttcaagatcgcaaaaaactcaggatagtgcctcgaaaactcaaggtgacagaacaaat
aaattatctgcaacagatgaaaatacagaagagaagatagttgcaagcaaaactaaaaaa
acagcaaccagtactaaatcgacaactacaagaaaagcagttgctaaaaaaacaattgcg
gcaaaagcagagggaaaacaaatatctaaagaagtaaaatcacaaatgaagaagcaacca
gcaagaaatacaaataaaaaggttgatgataaattggataagtcagaattaacaagcttt
aacacatatttattccatcaaggaaacaattatgaggcatataatatttttggagcccac
gctaaaactgaaaatgggaaaaaaggtgtacaatttgcaacttgggcacctaatgcaaaa
ggtgtttatgttgttggtgattttaatgaatttgaagtaagtgaagaatttaaacttgaa
aagattacggaaaatggtatatggaagggattttttacagagcctaaagttggtgataga
tataaatattgtgttatagaagaaagtggtgaaagaggagaatataaagctgatccatat
gcaatacaaacagagttaaggcctaataatgcatcaatcatatatacaccaaaggagttt
aagtggacagatgaaaaatggattgttaaaagaaataaaataaatgtattagagcaacca
ataaatatatatgaaatacatttaggatcatggaaaacaaatagtgagggtggattttta
acatatgagcagattactaaagagttacctaaatatttgaaagaaatgagttatacacat
gttgaaattatgcctcttgtagaacatccactagatgcgtcatggggatatcaaggtaca
ggatattattcaccaacaagcagatatggaaaccttgaagggctaaagaagttaataaat
aaattacatgaagaaaatataggagtaataatggattgggttccagggcatttttgtaaa
gattcacatggattatataagtttgatggaacaccaacatatgaatatcaagatgaatgg
agagctgaaaataaaggttggggaacttgtaattttgatttaggaagaacggaagtaaaa
agttatttgatatcaaatgcattatattggtttagagaatttcatattgatggtttaaga
gttgatgctgtatctagcatcttatatctagattacagtagatcacatggagaatgggta
ccaaataaatatggcggaaatggaaatttagaagcaatagattttctaaaacaactaaat
aaagcagttttcacagaatatccaacagctcttatgatagctgaagagtcaacagcttgg
cctaatgtcacaaaacctacaatctatgatggattagggtttaattttaaatggaacatg
ggttggatgaatgatactttagaatatgttcaaatagatcctgagtatagaaaacataat
cataaaaatataacttttgcaatgatgtacaattatgcagagaattatttattgccacta
tcacatgatgaggttgttcatggtaaaaaatctttaatagataagatgtggggagatgag
tggaataggtttgctggacttagagcttttattgggtatatgatgggtcatccaggtaaa
aagttgttatttatgggctctgaatttgcacaagaagtcgaatggagagaatattcacaa
ttagattggaatctgttagatgatttagaaattcataagaaaacacaattgttctttaaa
gatttgaataaattatatttaaataataaggctttttgggaattagatcatgattataaa
ggatttaactggatagaagcagataataatgaacaaagtattttaatttttgcaagaaga
agtagaagtgatgaggacacccttttgtttgtaattaacttcacatccacagtttattat
gattacaggataggagttccattcttaggtagttatgaagaaatatttaatacagatgat
acgaaatacggtggttcaggacaaattatggatgaaacattaattgctgaaaaagtacaa
ttccacaagcaaccatattcattacaaataaaagtaccaccaatggcagccttagtgtta
aaggttaaggaaattaagatggaaattggaacagatgaagaagtaatagaggaaatataa

DBGET integrated database retrieval system