KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c57850Help
Entry
Cspa_c57850       CDS       T02467                                 

Gene name
gtfA2
Definition
(GenBank) sucrose phosphorylase GtfA
  KO
K21350  
sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
csr  Clostridium saccharoperbutylacetonicum
Brite
Enzymes [BR:csr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     Cspa_c57850 (gtfA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6475833..6477302
Genome map
AA seq 489 aa AA seqDB search
MAIKNQVQLITYPDSLGGDLKTLNNILLKYFSDIFKGGVHILPPFPSSGDRGFAPLTYFE
IDPKFGTWEDIRHIGENFDVLLDLMVNHISKESEFFQDFLEHGKKSEYADLFLTLDKIWS
DGKPVQEDISKMFLRRRQPYSTFTISETGEEETVWTTFGKEDPSEQIDFDINSPKVKELL
KDFLTNFSKQNVKIVRLDAVGYVIKKLGTSCFFIEPEIYKFIDWITELATSLGLELLPEV
HAHYTTQFKLAEHGSWIYDFILPYRILDTLINKSNSELYKYLKVRPHKQFTMLDCHDGIP
VKPDLDDLINTKDAKNLVDLCVERGSNLSLIYSDAHKAKDGFDVHQIRCSYYSVLNCDDD
AYLAARAIQFFTPGIPQVYYVGLLAGKNDEENVKLTGEGREINRHNFTSIEIEQEVQKEV
VQRLLKLIKFRNEYPAFNGEFNIVNSEDDEIILSWKKDKKFCTLNICLQTNKSVIEYVDD
NGDILIYNI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaaaatcaagtacaacttattacttatcctgattctcttggtggagattta
aagactcttaataacatacttttaaaatatttttctgatatatttaaaggcggcgttcat
atacttcctccattcccttcttcaggagacagaggctttgcaccattaacttactttgaa
attgaccctaaattcggtacttgggaagatattagacacattggtgaaaattttgatgtt
cttttagacttaatggtaaaccatatttccaaagaatccgaattttttcaggacttctta
gaacacggaaaaaaatcagaatatgctgatcttttcctcacattagataaaatttggagt
gatggaaagcctgttcaagaagatatttctaagatgttcttacgaagaagacaaccttat
tcaactttcactataagcgaaactggtgaagaggaaactgtttggactacttttggaaaa
gaagatccttctgagcaaatagactttgatattaattcaccaaaagttaaggaattatta
aaagattttcttacaaacttcagcaaacaaaatgtcaaaatagttagattagatgctgtt
ggatatgtaattaaaaaattaggaaccagctgctttttcattgaaccagaaatttataag
tttattgactggattacagaactggcgacttctttaggacttgaactacttcctgaagtt
catgctcactacacaacccaatttaagttagcagaacatggtagctggatatatgatttt
atacttccttatagaattcttgatacattaataaataaatctaactcagaactttacaaa
tatttaaaagttcgtcctcataaacaatttacaatgctggactgccatgatggcattcct
gttaagcctgacttagatgacttaataaacactaaagacgctaagaatttagttgatctc
tgtgtggaaagaggttcaaacttaagtctcatttactctgatgcacataaagctaaagat
ggctttgatgttcatcaaataagatgctcttattattcagttttgaactgtgatgatgat
gcttatcttgctgcaagagcgattcaatttttcacccctggtatccctcaagtatactat
gtaggcttgttagcaggaaaaaatgatgaagagaatgtaaaactaactggtgaaggccgt
gaaataaatagacacaacttcacatctatagaaattgaacaagaagtccaaaaagaagtt
gttcaaagacttcttaaacttataaaatttagaaatgaatatccagcatttaatggtgaa
ttcaatattgtaaattctgaagatgacgaaataattctctcatggaaaaaagataaaaaa
ttctgtacattaaacatatgtcttcaaacaaacaaatcagttattgaatatgttgatgat
aatggagatatattaatatacaatatttaa

DBGET integrated database retrieval system