KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c01040Help
Entry
Cst_c01040        CDS       T02440                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme GlgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cst_c01040 (glgB)
Enzymes [BR:css01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cst_c01040 (glgB)
Exosome [BR:css04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cst_c01040 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(107160..109385)
Genome map
AA seq 741 aa AA seqDB search
MGYVFDENGIEAVICGFHKNPHEILGMHTQGDETAICAYIPNAKHIEVVFYKSGLSYEMD
KKDDRGFFTVIIPGRPENSMYKFKVTDHTGHRFETYDPYSFLPTISDYDLYLFNEGTHHR
IYEKLGAHIRNINGVSGVSFCVWAPEAKRVSVVGDFNQWDGRRHQMRMLGSSGVWEIFIP
GLVKNDIYKYEIKTPFDEIYLKADPYAFYAEKPPKTASKVYDLHNYEWHDEQWMKQREKE
STFDKPLNIYEVHLGSWMQQPDPDPESETGFKPLSYRQLAEKLVPYVKEMGYTHIELLPV
MEHPYDGSWGYQITGYYAVTARYGIPEDFKYFIDTCHQNGIGVILDWVPVHFPKDGHGLA
RFDGTACYEHEHPLLGEHHQWGTHIFNFSRNEVRSFLISNAIYWFDIFHVDGLRVDAVAF
MLYLDYCRNDGEWIPNRYGGRENLDAIEFLKQLNCAVYKYFPNVLMIAEDSTAWPMVTRP
VHVGGLGFSHKWNMGWMNDFLRYMSMDPIYRKYHHNLITFSFMYAWSENFILVLSHDEVV
HGKCSLLNKMPGDYWQKFAGLRAALGYFIGHPGKKLLFMGGEFGQFIEWKYKESLDWHLL
SYPMHEKLHRYVRELNNLYLNEPALYEVDFHYDGFEWIDCNDTENSIVSFIRKGKDWRDM
LIFVCNFTPVTHENYRIGAPFYTYYEEVFNSDREKYGGSNVINAGKIHSENIPYHHRPYS
LVLRIPPLATIILRPDLKNFR
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgtcttcgacgaaaatggaatagaagcggttatatgtgggtttcacaaaaat
ccgcacgaaatattgggtatgcacacacagggtgatgagaccgcaatatgcgcatacata
cccaatgcaaagcatattgaagttgtcttctacaaaagcggattatcctatgaaatggac
aagaaggacgatcgggggttctttacagtaataattcccggtcgtcctgaaaattcaatg
tataagttcaaagtcaccgatcatacaggtcatcgttttgaaacttacgatccttattcc
tttttgcctacgatatccgattatgatttatatctcttcaacgaaggcacccatcacagg
atctatgaaaaattaggtgcccatatacgaaatattaacggtgtttcgggggtgtctttc
tgcgtctgggctcctgaagcgaaaagagtcagtgttgtcggcgacttcaaccaatgggac
ggaagaaggcaccagatgagaatgctgggaagttcaggggtttgggaaatatttattccc
gggctggtgaaaaatgatatctataaatatgaaatcaaaacaccgtttgacgaaatttat
cttaaggccgacccctatgcgttttacgcggaaaagccgccgaaaaccgcatccaaggta
tatgatctgcacaattacgaatggcatgacgaacaatggatgaaacaacgtgaaaaagaa
agcacttttgacaagcctttaaatatttatgaggtgcatttgggttcgtggatgcagcag
cccgatcccgatcctgagtccgaaacaggctttaagcctttaagttacagacagttggcc
gaaaaactggttccatacgttaaggaaatgggttatacgcacatagagctgttacctgtt
atggagcatccttatgacggctcatggggatatcagatcacgggatactacgccgtaacg
gcgcgctacggcatacctgaggattttaaatactttattgacacctgtcaccagaacggc
ataggcgtaattctggactgggttcccgtccatttcccgaaagacggacacggacttgcc
aggtttgacggcaccgcgtgctatgagcatgaacatcctctccttggggaacaccatcag
tggggaacgcatattttcaatttttcccggaatgaagtccgaagctttttaatatcgaac
gcgatttactggtttgatattttccacgtcgacgggttaagggtggatgccgttgcgttc
atgctgtacctggattattgccggaacgacggcgaatggattccgaacaggtacggaggc
agggaaaaccttgacgcaatagaatttttaaaacagctaaactgcgccgtatacaaatat
ttcccaaatgtattaatgattgcggaggattccacggcctggccgatggtgacaaggcct
gtgcatgtcggaggccttggcttttcacacaaatggaatatgggctggatgaacgatttt
ctaagatatatgagcatggatccgatataccgcaaataccaccataaccttataaccttt
tcgtttatgtatgcgtggagcgaaaatttcatacttgtgctgtcccatgacgaagtggtg
catggtaagtgttcactgttaaacaaaatgccgggggactactggcagaaatttgcgggt
ctcagggcggcgctgggctatttcatcggccaccctggaaaaaaacttctgtttatggga
ggggagttcggccagtttattgaatggaagtacaaagaaagccttgactggcacctctta
agttacccgatgcatgaaaaactgcacaggtatgtgagggaacttaataatttatatctt
aatgaacccgcattatatgaagtggatttccattatgacggtttcgaatggatagactgc
aatgataccgagaacagcattgtatcctttatccgtaaaggtaaggactggcgggatatg
ctgatcttcgtatgcaacttcacgcccgtaacccatgaaaactatcgcatcggcgcgcct
ttttacacatactacgaggaagttttcaacagcgaccgggaaaaatacggcggaagcaat
gtcataaatgccggtaaaattcattccgaaaacattccctatcaccacaggccatattca
ctcgttctgagaatcccgcctctggcgacaataattttaaggcctgatttaaaaaatttc
agataa

DBGET integrated database retrieval system