KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c02100Help
Entry
Cst_c02100        CDS       T02440                                 

Gene name
cheB1
Definition
chemotaxis response regulator protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:css02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:css02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(225246..226310)
Genome map
AA seq 354 aa AA seqDB search
MIKVLIVDDSSFMRVRIRTLLETCSEIKVVGIARNGMDAVRKTVVLRPDVITMDINMPDM
SGIEAVELIMKQCPTPIIMVSSLSSDGANETLEALEKGAVDYIHKDNLNEKNLIEKILIA
KNAKLNINGHSAPKISKNIIQETREKILAETLRLQKTTEILSGRRTFSIIGIGISTGGPS
ALAKVLPRISAEIPASIVIAQHMPSAFTGPLAERLNRISALHVKEAENGEQLIPGYAYIC
PGGKHIMVEKKGIITLYDREKFPNYHYCPSASLLMASISRVYANNAMCIIMTGMGSDGLE
GVLEAKKNGSYVIAQSENSSVIFGMPKAIISNNLQDEIVHLDHIADRINELCLE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagttttgatagtagatgattcttcttttatgcgcgtcaggataaggacactc
ctcgaaacctgcagtgaaataaaagttgtcggcatcgccagaaacggtatggacgcagta
cgtaaaaccgttgttctcagacccgacgttattactatggacataaacatgccggatatg
tccggaatcgaggccgttgaactcataatgaaacagtgccccactcctatcataatggta
agttcactgtcctctgacggtgccaatgaaacgcttgaagctttggaaaaaggggcggta
gactacatacacaaggataatctgaatgaaaaaaacctgatagagaaaattcttattgcc
aagaatgcaaaacttaacataaatggccattccgcgccaaaaatttccaagaacattatt
caggaaaccagggaaaaaattttggccgaaaccttaagacttcagaaaactactgaaata
ctttcagggcgaaggacattttcaataatcggaattggaatttcgacgggaggcccaagc
gcattggcgaaagtactgccccgaatatccgccgaaatcccggcaagcattgtaatagcc
cagcatatgccttccgcttttacaggccctctggctgaaaggctgaacaggatttccgca
ttgcatgtcaaagaagccgaaaacggcgagcaattaatacccgggtatgcatatatatgt
ccgggcggtaaacatataatggttgaaaaaaaaggcattattactttatatgacagggag
aaattccctaattaccattactgcccttcggcaagccttttaatggcgtcaatttccagg
gtatacgccaacaacgccatgtgcataataatgacaggaatgggttcagacggccttgaa
ggggttcttgaagcgaagaaaaacggaagttacgtcatcgcgcagtccgaaaattcttct
gttattttcgggatgccgaaagcaattataagcaataacctgcaggatgaaattgtacat
ctggaccatatcgccgacagaattaatgagttatgccttgaatga

DBGET integrated database retrieval system