KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c05890Help
Entry
Cst_c05890        CDS       T02440                                 

Definition
(GenBank) lysyl aminopeptidase
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
620012..621058
Genome map
AA seq 348 aa AA seqDB search
MDTVTLVKQLCDLNAPVGSEHLAAEKLKSLFEPYCDEVYVDDFFNVTGYKKGTSDKPGKI
IITAHYDQIGMIVSGFEKGGFLRISNLGGVDTKALLAREVIVHGREEVYGVIGAKPPHLL
KDDETNKNVSINELFIDTGYTDDVIKQKVSVGDPVTVVASVAEMKNRCVAGRSLDNRAGV
AALVLILKELRNIKHPNDIYVIATVQEETGLLGAVASSYSLEPDLAVVIDVCHGDMPDAD
KSQCFPLNKGVPVGVGPAFHSEYTVALFETARRERIPTQRCIEPGNPGTEAWAIQVSRTG
VPTVEVGIPLRYMHTTAELISLQDLENAAVLVARYVSGDILKKSEEFE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggatacggttactttggtcaaacagctttgcgatttgaatgcaccggttgggagcgag
catctggcagcagagaagttaaagtcccttttcgagccgtattgcgatgaagtttatgtg
gatgatttctttaacgtaacaggatacaaaaaaggaacttcggataaaccggggaaaatt
atcatcaccgcccattatgatcagataggaatgatcgtgtccgggtttgaaaagggagga
tttttaaggatatccaatctcggaggtgtggatacaaaagccctgcttgcccgtgaggtg
attgttcacggcagggaagaagtttacggtgttataggcgcaaagccaccgcatctttta
aaggatgacgaaacaaataaaaatgtgagcataaacgaactttttatcgacacgggctac
acggatgatgttataaagcaaaaggtttcggtaggcgatcccgtaacggtcgtcgcctcg
gtggctgaaatgaagaaccggtgtgtggccggcagaagccttgacaaccgcgcaggggtg
gcggcacttgtgttaatccttaaggaactgaggaatataaagcatccgaatgatatatat
gtaatagcgactgttcaggaagaaacagggcttttgggagcggttgcctcgtcgtattcc
ctggaaccggacctggcggtggttattgacgtatgccatggagacatgcccgatgccgac
aaatcccagtgttttcccctgaataaaggagttccggtgggtgtcggccctgcatttcac
agtgagtataccgttgccttgtttgaaaccgccagaagggaacggatacctacacagcgc
tgcatagagcccggaaacccgggcaccgaagcatgggccattcaggtatcccggaccggt
gttccgacggttgaggtgggaatacctctgaggtacatgcatacaaccgccgagctgatt
tcattgcaggatttggaaaatgcggccgtacttgtggcaaggtatgtttcgggggatata
ttgaaaaaaagcgaagagtttgaatag

DBGET integrated database retrieval system