KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c05900Help
Entry
Cst_c05900        CDS       T02440                                 

Definition
(GenBank) peptidase M42 family protein
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
621119..622150
Genome map
AA seq 343 aa AA seqDB search
MRQKLAELTWLDGISGNEQNVRNFIIQNLPDKSLKYYVDNIGNLIVKGRSNGNCNLRVMV
AAHMDEVGFMVNYITDDGKLKFSPVGGVDSRILIGQHVRVGKDKIPGVIGYKSIHLQDKS
ERESVVKIKSLYIDIAAKDRENAQELVSTGDYVAFASEPVFFGDGKIKAKALDDRAGCAV
IMELLKETWPFELYACFTVQEEIGLRGALVAANRVKPDIGIVLEGTTCADVPKVKEHETS
TVMGKGPSISFADRTSLADRELFNHFINTAEKEGIRYQIKNTVSGGNDAGRIQTSGTGVR
TLVVSVPCRYIHSPVSVLDLNDLDNMLKLVSRSLHTLPEALGR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaaaacttgccgaacttacatggcttgacggcatatcaggaaatgagcagaac
gtacgcaattttataatacaaaaccttcccgacaaatcgctgaagtattatgtggacaat
atcggaaacctgattgtaaaaggcagaagcaatgggaactgcaatctgagggtaatggtt
gccgcgcatatggacgaagtgggttttatggtcaattatataaccgacgacggaaaactt
aaattttcccccgtcggcggcgtggatagccgtattctgattggtcagcatgtgcgtgtg
ggaaaggataaaattccgggcgtaatcgggtataagtccatccatttgcaggacaaaagc
gaaagggagagcgtcgtaaaaatcaaaagcctttatatagacatagccgcaaaggacagg
gaaaatgcgcaggagcttgtcagcaccggcgattacgtcgcctttgcctcagagcctgtt
tttttcggcgacggaaaaataaaggcgaaggcactggacgacagagcgggatgcgcggta
attatggaacttctgaaggaaacctggccgtttgaattgtatgcgtgttttactgtgcag
gaagaaatagggcttagaggggcacttgtcgcggcaaacagggttaagcccgatatcggc
attgtgcttgagggaacaacctgtgctgacgtcccgaaggtaaaggagcatgaaacgtcg
acggtaatgggaaagggaccgtcaataagctttgccgacaggacttctctggccgacaga
gagctttttaatcactttataaataccgctgaaaaggaaggcattcgatatcagattaaa
aacacggtgtccggcggaaatgacgctggaagaatacagacatcgggtacgggggtcagg
actttggttgtatcggttccgtgtcgttatattcattcgccggtatcggtccttgatttg
aatgatctggacaatatgctgaaactggtaagcaggtctttgcatacattgcctgaagca
ttagggaggtag

DBGET integrated database retrieval system