KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c07090Help
Entry
Cst_c07090        CDS       T02440                                 

Gene name
xynB
Definition
endo-1,4-beta-xylanase XynB (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
748007..749170
Genome map
AA seq 387 aa AA seqDB search
MNKFLNKKWSLILTMGGIFLMATLSLIFATGKKAFNDQTSAEDIPSLAEAFRDYFPIGAA
IEPGYTTGQIAELYKKHVNMLVAENAMKPASLQPTEGNFQWADADRIVQFAKENGMELRF
HTLVWHNQTPDWFFLDKEGKPMVEETDPQKREENRKLLLQRLENYIRAVVLRYKDDIKSW
DVVNEVIEPNDPGGMRNSPWYQITGTEYIEVAFRAAREAGGSDIKLYINDYNTDDPVKRD
ILYELVKNLLEKGVPIDGVGHQTHIDIYNPPVERIIESIKKFAGLGLDNIITELDMSIYS
WNDRSDYGDSIPDYILTLQAKRYQELFDALKENKDIVSAVVFWGISDKYSWLNGFPVKRT
NAPLLFDRNFMPKPAFWAIVDPSRLRE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattcttaaacaaaaaatggagcttaattttaaccatgggaggtatttttctg
atggcgactttatcattgatttttgcaacggggaaaaaggcctttaacgatcaaacttct
gctgaagacatcccatcgcttgctgaggctttcagagactattttccgattggagcggcc
attgagcctgggtataccacaggccaaatagccgaactgtataagaaacacgtgaacatg
ctcgtggcggaaaatgcaatgaaaccggcgtcacttcagccgacggaaggtaattttcag
tgggcagacgctgacagaattgtgcagtttgcgaaagaaaacggtatggaactgcgcttc
cacactcttgtgtggcataatcagacgcccgactggtttttcttggataaagaaggaaaa
ccaatggtggaggagactgatccacagaagcgtgaagaaaacaggaaacttctgctgcaa
cggcttgagaattatattcgtgctgtggttttacgctacaaagacgacataaagtcatgg
gatgtggtgaatgaggtaattgaacccaatgatcccggcggtatgagaaacagtccttgg
tatcagattaccggtaccgagtacatcgaagtggcattccgtgcggcaagggaagcggga
ggatccgatattaagctttatatcaacgattacaatacagatgaccctgtcaagagagat
atactgtatgaattagtgaaaaatttgctggagaagggtgtgccgattgacggggtggga
catcagacacatattgatatttacaatccgcctgtcgagcgaataatagagtctataaaa
aaatttgccggactgggactggacaacataattaccgaactggacatgagcatatattca
tggaatgaccgcagcgattacggcgatagtatacccgattatatcctgactttacaggcc
aaacgttatcaggaactgtttgatgcgttaaaggaaaataaggacattgtaagcgcagtg
gtgttttggggcatttcggacaaatattcctggttgaacgggtttcctgtaaaacgtacc
aatgccccgctgctgttcgacagaaatttcatgccgaaaccagctttctgggcgatagtt
gatccttcacggttgcgggaataa

DBGET integrated database retrieval system