KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c07090Help
Entry
Cst_c07090        CDS       T02440                                 

Gene name
xynB
Definition
endo-1,4-beta-xylanase XynB (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Brite
Enzymes [BR:css01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cst_c07090 (xynB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
748007..749170
Genome map
AA seq 387 aa AA seqDB search
MNKFLNKKWSLILTMGGIFLMATLSLIFATGKKAFNDQTSAEDIPSLAEAFRDYFPIGAA
IEPGYTTGQIAELYKKHVNMLVAENAMKPASLQPTEGNFQWADADRIVQFAKENGMELRF
HTLVWHNQTPDWFFLDKEGKPMVEETDPQKREENRKLLLQRLENYIRAVVLRYKDDIKSW
DVVNEVIEPNDPGGMRNSPWYQITGTEYIEVAFRAAREAGGSDIKLYINDYNTDDPVKRD
ILYELVKNLLEKGVPIDGVGHQTHIDIYNPPVERIIESIKKFAGLGLDNIITELDMSIYS
WNDRSDYGDSIPDYILTLQAKRYQELFDALKENKDIVSAVVFWGISDKYSWLNGFPVKRT
NAPLLFDRNFMPKPAFWAIVDPSRLRE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattcttaaacaaaaaatggagcttaattttaaccatgggaggtatttttctg
atggcgactttatcattgatttttgcaacggggaaaaaggcctttaacgatcaaacttct
gctgaagacatcccatcgcttgctgaggctttcagagactattttccgattggagcggcc
attgagcctgggtataccacaggccaaatagccgaactgtataagaaacacgtgaacatg
ctcgtggcggaaaatgcaatgaaaccggcgtcacttcagccgacggaaggtaattttcag
tgggcagacgctgacagaattgtgcagtttgcgaaagaaaacggtatggaactgcgcttc
cacactcttgtgtggcataatcagacgcccgactggtttttcttggataaagaaggaaaa
ccaatggtggaggagactgatccacagaagcgtgaagaaaacaggaaacttctgctgcaa
cggcttgagaattatattcgtgctgtggttttacgctacaaagacgacataaagtcatgg
gatgtggtgaatgaggtaattgaacccaatgatcccggcggtatgagaaacagtccttgg
tatcagattaccggtaccgagtacatcgaagtggcattccgtgcggcaagggaagcggga
ggatccgatattaagctttatatcaacgattacaatacagatgaccctgtcaagagagat
atactgtatgaattagtgaaaaatttgctggagaagggtgtgccgattgacggggtggga
catcagacacatattgatatttacaatccgcctgtcgagcgaataatagagtctataaaa
aaatttgccggactgggactggacaacataattaccgaactggacatgagcatatattca
tggaatgaccgcagcgattacggcgatagtatacccgattatatcctgactttacaggcc
aaacgttatcaggaactgtttgatgcgttaaaggaaaataaggacattgtaagcgcagtg
gtgttttggggcatttcggacaaatattcctggttgaacgggtttcctgtaaaacgtacc
aatgccccgctgctgttcgacagaaatttcatgccgaaaccagctttctgggcgatagtt
gatccttcacggttgcgggaataa

DBGET integrated database retrieval system