KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c07340Help
Entry
Cst_c07340        CDS       T02440                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00790  Folate biosynthesis
css01100  Metabolic pathways
Module
css_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cst_c07340 (folE)
Enzymes [BR:css01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cst_c07340 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AGC67739
UniProt: L7VM81
Position
773860..774420
Genome map
AA seq 186 aa AA seqDB search
MNTEKIKSLIRELIIEIGDDPDREGLIETPSRVAEMFKEIFSGYQDIPENTVKLFKETKH
GDGIIIKDIPFYSMCEHHIMPFFGVIDVAYIPNNESILGLSKFSRIVDYYSKRLQLQECL
GEQICDFIMKEVNARGAMVIIKAEHLCMSMRGVKKSGVNTITKTSKGVFNDNSELRMEYL
SLLLNM
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgaaaaaataaaatcattaattagggagttaataatagaaataggggatgat
cctgatagagaaggtttaattgaaaccccttctcgcgtagcagagatgttcaaggaaatt
ttttcgggttatcaggatataccggaaaatacagttaaattatttaaagaaacaaaacat
ggtgatgggattattattaaagacattcctttttattcaatgtgtgaacaccatattatg
ccgttttttggagtaatagacgtagcatatattcccaataatgaatctatattagggtta
agtaaattttcgcgaatagttgattattacagcaaaaggttacaactacaggaatgtctg
ggagagcagatatgtgattttatcatgaaggaagtcaatgcccgtggtgctatggtaata
ataaaagcagagcatttatgcatgtcgatgagaggagttaagaaatccggagttaatact
attacaaaaacttcaaaaggcgtgtttaatgataattctgaacttagaatggaatattta
tctttattgttgaatatgtaa

DBGET integrated database retrieval system