KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c14170Help
Entry
Cst_c14170        CDS       T02440                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cst_c14170 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cst_c14170 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cst_c14170 (thrC)
Enzymes [BR:css01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cst_c14170 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1531149..1532642)
Genome map
AA seq 497 aa AA seqDB search
MRYRSTRGGFSGVTSSEAIKMGIAPDGGLFVPEDDVTVDLKFIENLVSDNYRQRAEKILS
FFLTDFDRAELEECVKKAYGNNFSSPEVTPLVHLHEHLHMLELWHGPTCAFKDMALQILP
HFMVKAIKKTGENSKIVILTATSGDTGKAALEGFADVDGTYIIVFYPNGGVSEIQRLQMV
TQTGKNTNVIAVNGNFDDTQSGVKKIFNDKNICDKIQDKGFRFSSANSINWGRLVPQIVY
YFSAYADLLKDKIIEPGEKINFVVPTGNFGNILAAWYAMKMGLPVNRLICASNENNILTD
FIITGTYDRRREFHKTLSPSMDILISSNLERLLFELGGKDAGLIRGYMNDLNEKGYYTVN
KTIKGKIQEIFWGGYSSDNETLACIRSVYKDYGYVLDTHTAVAMDVYDKYVIYSGDLTQT
VIVSTASPFKFSGSVAKALFGDETEGLDEFGLLRLLSEKTGWEIPKGLKDLDRKEILHKT
VCEKDEMGDVVLNILNS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacagaagcacacgcggtggattttccggcgttacttcttcggaagcaattaaa
atgggtattgcgcctgacggcgggctgtttgttccggaagatgacgtaactgttgattta
aagtttattgaaaatttggttagtgataattaccggcaaagagcagaaaaaatactttct
ttttttctgaccgattttgacagggcagaattggaagaatgcgtaaagaaagcctatggg
aataatttttcatctcccgaggttactcctcttgtacatctgcacgagcatcttcatatg
cttgagctctggcacggccctacctgtgcttttaaggatatggctttgcaaatacttccg
cactttatggtaaaagccatcaagaaaacaggagaaaattcaaaaatagttatacttacg
gctacatccggtgatacaggcaaggctgcacttgaaggatttgcagacgtcgacggcacg
tatatcattgtattctatccaaacggcggagtaagtgaaatccagagacttcagatggtt
actcagacaggcaaaaatacgaatgttatagccgtaaacgggaatttcgacgatactcag
agcggcgtaaaaaagattttcaatgacaaaaacatatgtgataagatacaggacaaaggt
ttcaggttttcatcggcgaactcgataaactggggaagactggttccgcagattgtatat
tatttttccgcatatgcggatttattgaaggataaaatcattgaacccggagagaagata
aattttgtggttccgacaggtaatttcgggaatattcttgcggcatggtatgcgatgaaa
atggggctgcctgtgaacaggcttatatgtgcatcaaatgaaaataatatacttaccgac
tttattattacaggaacatatgacaggagaagggaattccataaaactctgtctccgtca
atggatatacttatttccagtaatcttgaaaggctgctttttgaactcggaggaaaagat
gccgggcttatacgcggttatatgaacgacctcaacgaaaagggttattatacggtgaac
aaaacaattaagggaaaaattcaggaaatattctggggaggatattcgagtgataatgaa
accctcgcctgcataagaagcgtttacaaggattatggttatgtattggatactcacact
gcagtggcgatggacgtttatgacaagtatgtaatatatagcggagatcttactcagacc
gtaatcgtttccaccgcaagcccgttcaagttcagcggcagcgtagcaaaggctctgttc
ggtgacgaaaccgaagggcttgacgagttcggacttctgaggctgctttcggaaaaaacc
ggctgggagataccaaaaggattaaaagatctggacaggaaagaaatacttcacaaaacg
gtctgcgaaaaggatgaaatgggtgacgtagttcttaatatccttaattcgtaa

DBGET integrated database retrieval system