KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c17700Help
Entry
Cst_c17700        CDS       T02440                                 

Gene name
cheB2
Definition
chemotaxis response regulator protein-glutamate methylesterase 2 (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:css00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cst_c17700 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cst_c17700 (cheB2)
Enzymes [BR:css01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cst_c17700 (cheB2)
Two-component system [BR:css02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Cst_c17700 (cheB2)
Bacterial motility proteins [BR:css02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cst_c17700 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1923447..1924493)
Genome map
AA seq 348 aa AA seqDB search
MELGGDSVGNGRTIKVLVVDDSIVFRELLTLGISSEPEIKVVATAKDPFEARDKILIYKP
DVITCDVEMPKMNGIEFIRRLIPQYPVPVIVVSSVSGVVFDALNAGAVDFVEKPNMGDVT
NVKQFIYSLIEKIKVASNAKIVQNTVKSSMQPEGTSEAFDSRKIIAIGASTGGTEAIAKI
LKGMPPTIPGIVIVQHIPPVFSRLFAERLNSSTQLRVKEAETGDYVEQGKVLIAPGDKHM
RIKKVANRYKVECFNGEKVNGHCPSVDVLFESVAKEAGKDAIGVILTGMGYDGAKGLLAM
KRKGAYTIGQDEHSSVVYGMPKVAYNIGAVTRQLSLERIAASIMEMVR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggagttgggaggagattcggtgggaaacggcagaaccataaaagttcttgtggttgac
gacagtattgtatttcgcgaattattaacgctgggtatctcatcggagcctgaaataaag
gttgtggctacagcgaaggatccttttgaagcaagagataaaatactgatatataagcct
gatgttataacatgtgacgtggaaatgccaaaaatgaacggaatagaatttatacggaga
cttattcctcaatatccggtacctgttattgtggtaagttcggtaagcggcgtggttttc
gatgcattgaatgccggtgcggttgattttgttgaaaaaccgaatatgggagatgtgaca
aatgtaaaacagtttatttacagcctcattgaaaagataaaagttgcgtcaaatgcaaaa
atagtacagaatacggtgaaaagttccatgcagcccgaagggacgtcggaagcctttgat
tcacgaaaaataatcgctataggggcttctaccggaggaaccgaggcaatagcgaaaata
ctgaaaggcatgcctccgacaattcccggaattgttatagttcagcatataccccctgta
ttttcaaggctttttgctgaacggctgaattcatccacacaactccgtgtgaaagaggca
gaaaccggtgactatgtggaacagggaaaagtgctgatagctcccggggataagcatatg
agaataaagaaagtggcgaacaggtacaaggtggaatgttttaatggtgaaaaggtcaac
ggacactgtccgtcggttgatgtattgtttgaatctgttgcaaaagaagccggaaaggac
gccattggggttatcctcaccggaatgggttatgacggagcaaagggcctgcttgcgatg
aaaagaaaaggagcgtatacaatcggccaggacgagcattcttcggtggtttatggcatg
cctaaagtggcatataacattggtgccgtgaccaggcaactttctctggagcggatagcg
gcatcaataatggagatggtaaggtaa

DBGET integrated database retrieval system