KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c17750Help
Entry
Cst_c17750        CDS       T02440                                 

Gene name
asnO
Definition
asparagine synthetase AsnO (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:css00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1928885..1930729)
Genome map
AA seq 614 aa AA seqDB search
MCGIAGFCNLNTDYTRNSEYWHQILVDMRKSVSHRGCDNTGEYLRRNVGLGHTRLAIRDL
CFGAQPIVRNISGKEYVIVYNGEIYNTDELTPELKREGFVFETTTDTEVILYAYIHHGID
FVSRLNGIFAFAIWDEACERLVLYRDRLGVKPLFYTIKDDTLVFGSEIKALFCFPAVKPE
IDIEGLREIFGVGPARTPGNGVFKGINEIKPGHYAVFSKEGFNVKRYWELESRPHTDSYE
ETVDKVSFLVRDAVKRQMVSDVPVCSFLSGGIDSSIVTAVASGYLSGFGLKLNTFSFDFK
DNGIYFKSNSFQPERDRPYVDIMLSEYNLNHTYLECDECLLADLLFDVVDAKDLPGMADI
DASLLYFCRLVKAHNKVALTGECADEIFGGYPWFYRNELLWTDGFPWSRDISARTLLLTD
DFVKELNLHEYVSERYSDSLKSVPFLEGESPADKRRREITYLNIKWFMQTLLDRMDRASM
YSGLEARVPFADHRIIEYVFNVPWDMKLKDGVEKSLLRESCKDLLPRKLLYRKKSPYPKT
YHPNYERLLSQMFTDILNDPNSPIVSLVDKNKAMIFLKSPSEYGKPWFGQLMAAPQLLAY
MIQVNYWLEKYSLL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgcaggtttttgtaatttaaacaccgattatacccgtaacagtgaatac
tggcatcaaattcttgttgatatgagaaagtctgtttcacaccgcggatgtgacaatacc
ggtgaatatctgagaagaaatgtcgggcttggccatacccgcctggcaataagggattta
tgtttcggggcgcagcctattgtcagaaacatcagcgggaaagaatacgtaattgtttat
aacggagaaatctacaataccgacgaattaacgcctgagctgaaaagagagggatttgtt
tttgaaaccacaaccgacaccgaagtaattctatatgcttatattcatcacggcattgat
ttcgtaagcaggcttaacggtatcttcgcctttgcaatctgggacgaggcttgtgaaaga
ctggtattgtatcgtgaccggcttggcgtaaaaccgttattctatactataaaggatgat
acgctggtcttcggatccgaaataaaggcccttttctgcttcccggcagtaaaacctgaa
atagacattgaaggtctgagggaaattttcggtgtcggccctgcaagaacgcctggaaat
ggtgtctttaagggtataaatgagataaaacccgggcattacgctgttttttcaaaagaa
ggttttaatgtcaaaaggtattgggagcttgaaagccgtccgcatacagacagctatgaa
gaaacggtggataaggtttcatttctcgtcagggatgcggttaaaagacagatggtttcg
gatgttccggtttgcagttttctttcaggtggtatagactcaagtattgtaactgcagta
gcttcgggctacttgtccggatttggcttgaaactgaatactttttcctttgacttcaaa
gacaacggtatctactttaagtccaattcctttcagcccgaacgtgacagaccttatgtg
gatattatgttatcggaatataatcttaaccatacatatcttgaatgtgacgaatgcctt
ctggccgatttgcttttcgacgtggttgatgcaaaggatctgccgggtatggccgatatc
gatgcgtcgcttttgtatttctgcaggctggtgaaagcccataataaagttgcgttaacc
ggtgagtgcgctgatgaaattttcggcggctatccgtggttttacagaaatgaactttta
tggactgacggttttccgtggtcaagggatatatcggccagaacattgctattgacggat
gattttgtaaaagaacttaatcttcatgaatatgtttccgaaagatattcggattcatta
aaatcggttccctttctggaaggcgaaagcccggcggataaaaggcgcagggaaattact
tatctgaacataaagtggttcatgcaaacactgcttgacaggatggacagggcaagcatg
tactcggggcttgaggcgagagtgccgtttgcagaccacagaataattgaatatgtattt
aacgttccgtgggacatgaagcttaaagacggggtggaaaagtcccttttacgtgagtcg
tgcaaggatctgttgccccgtaagcttctgtaccgtaaaaaaagcccgtatccaaagaca
tatcatccaaattatgaaagattgctttcacaaatgtttaccgatattttaaatgatccg
aattctccgattgtttcgctggtagataagaacaaagccatgatatttctgaaatctccg
tctgaatacggaaaaccgtggttcggacagttaatggcggctccgcagcttttagcttat
atgatacaggtaaattactggcttgagaaatattctcttctttaa

DBGET integrated database retrieval system