KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c18840Help
Entry
Cst_c18840        CDS       T02440                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cst_c18840 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cst_c18840 (adhE)
   00620 Pyruvate metabolism
    Cst_c18840 (adhE)
   00650 Butanoate metabolism
    Cst_c18840 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    Cst_c18840 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cst_c18840 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cst_c18840 (adhE)
   00626 Naphthalene degradation
    Cst_c18840 (adhE)
Enzymes [BR:css01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cst_c18840 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cst_c18840 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2060777..2063494)
Genome map
AA seq 905 aa AA seqDB search
MENKERKIVDSVDALKKVIARVREAQRKFSTYSQEQVDEIFKAAATAANQARIPLAKMAV
EETGMGVVEDKVIKNHYAAEYVYNTYKNVRTCGVLEEDKAYGIKKIAEPVGVIAAVIPTT
NPTSTAIFKTLIALKTRNAVIISPHPRAKKCTIAAAKIVLDAAVAAGAPEGIIDWIDVPN
IELTNLLMKEADIILATGGPGMVKAAYSSGKPAIGVGPGNTPAVIDESADVVLAVNSIIH
SKTFDNGMICASEQSVIVHKNVYDAVKAEFAARGCYFLKEDEIEKVRKTIFVNGALNAQI
VGQPAYKIAELAGVKVPVGTKILIGEVDSTDPSEEFAHEKLSPVLAMYKAEDIHDAFEKA
ERLVANGGYGHTAAIYLDVTTEQAKIDEFASRLKTCRILVNTPSSQGAIGDIYNFKLAPS
LTLGCGSWGGNSVSENVGVKHLLNIKTVVERRENMLWFRAPEKIYIKKGCLPVALNELKY
VMGKKRAFIVTGSFLYHNGYTKPITDRLDELGIEHTTFFDVLPDPTLSCAKAGAEQMRAF
QPDTIIAFGGGSAMDAAKIMWVMYEHPEVDFMDMAMRFMDIRKRVYTFPKMGEKAYFVAI
PTSAGTGSEVTPFAVITDEKSGVKYPLADYELLPDMAIIDVDFHMSAPKGLTAAAGIDAL
THALEAYVSLMATDFTDGLAKQALQMIFKYLPRAYDNGQTDVEAREKMANAATIAGMAFA
NAFLGVCHSMAHKLGAFYHLPHGIANALMIEEVIRFNASEAPAKMGTFPQYGYPHALRRY
AEIAEALNLGGENDHEKLENLIKAINDLKARVGIKSSIKEYGINEKEFLERLDEMVEQAF
DDQCTGTNPRYPLMSEIRQMYLNAYYGKKHFVDEEKPNEADIAGTEDENKVKKAYLRARV
GAKRA
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaagaaagaaagattgtagacagtgtggacgcgttaaagaaagtcattgcc
cgggtaagggaagcgcaaaggaaattttcaacctattcccaggaacaggtggatgaaatt
tttaaggctgctgccactgccgcaaaccaggcaagaattccgctggcgaaaatggcggtg
gaagaaaccggtatgggcgttgtggaagataaagttataaaaaaccactatgccgccgaa
tatgtttacaatacgtataagaacgtaagaacctgcggggttttggaagaagataaggca
tacggtatcaaaaaaattgccgagcctgtcggtgtgattgccgctgttattcctaccact
aaccctacttccacggcaatttttaaaaccctgatcgcgctgaaaacacgcaatgccgtt
attatcagcccacatccgagagctaaaaaatgcaccatcgctgcggcaaaaatcgtattg
gatgctgccgttgccgcgggggctccggaagggattattgactggattgatgtgccgaac
attgagttgaccaatctgcttatgaaagaagcagacattatccttgccacaggtggtccc
ggtatggtgaaggcggcttattcctccgggaaaccggctatcggtgtcgggcctggcaat
actccggccgttattgatgaaagcgccgacgttgtccttgccgtgaactccattattcat
tccaaaacgtttgataatggtatgatttgcgcatcagaacaatcggtaattgttcacaag
aatgtttatgacgctgtaaaagctgaatttgcggcccgtggatgctatttccttaaagaa
gatgaaattgaaaaggtacgcaagacgatttttgtcaacggcgcgttaaatgcccagatt
gttggtcagccggcatacaaaattgccgaacttgccggtgtgaaagtgcctgtaggcaca
aaaatcctcatcggagaagttgacagcacagacccgtcggaagaatttgcccatgaaaag
ctgtcacctgtccttgcgatgtataaagctgaggatattcatgacgcttttgagaaagcc
gaacgtttggttgccaacggaggttacggtcataccgcagcaatttatttggatgtaacc
accgaacaggctaaaattgacgaattcgcttcgcgtttgaagacctgccgtatacttgtg
aatactccgtcttctcagggagctatcggcgacatttacaactttaagcttgcgccgtcg
ttaactcttggctgtggttcctggggcggaaattcggtttccgaaaatgttggggtaaaa
cacctgcttaatatcaaaacggttgttgaaagaagggaaaatatgctgtggttccgcgct
cccgaaaaaatatacatcaaaaagggatgtttgccggtagcccttaatgagttgaaatac
gtcatgggtaagaaacgcgcttttatagttaccggcagcttcctctatcacaatggttac
acaaagcccattaccgacagacttgacgaactgggcattgaacatacaacgttttttgat
gttttacccgatccgacgctttcctgcgcaaaagcgggagctgagcagatgagagccttc
cagcccgataccattattgccttcggtggcggatctgcgatggacgccgcgaaaatcatg
tgggtaatgtatgagcatcccgaagttgatttcatggacatggctatgcgttttatggat
atcaggaaaagggtttatacatttccgaaaatgggagaaaaggcgtattttgttgcaata
ccgacttctgcgggtaccggatccgaagtaactccttttgcggttatcaccgacgaaaag
agtggagtaaaatatcccctcgcagactacgagttgctccccgacatggcaattatagat
gtggattttcacatgagtgctcccaagggccttaccgccgcagcaggtatagatgccctc
acccatgcgcttgaggcgtacgtttctcttatggccactgattttaccgacggactggcg
aaacaggctctgcagatgatttttaaatacctgccccgcgcctatgataacggtcagacc
gatgtggaagcacgtgaaaaaatggctaatgccgccaccattgcaggtatggcgtttgca
aatgctttccttggtgtttgccattccatggcacataagctgggcgctttttatcatttg
cctcatggtattgccaacgcgcttatgatagaagaagtaatccgtttcaacgcttcggaa
gcaccggccaaaatgggaactttcccgcaatacggatacccgcacgctttaagacgttat
gccgaaattgctgaggcgcttaatctcggcggcgaaaacgatcatgaaaagctggaaaat
ctcattaaagccattaatgatctgaaggcaagggtggggatcaagtcatcaatcaaagag
tatggcataaatgagaaggaattcctggaacgcctcgacgagatggttgaacaggcattc
gacgaccagtgcaccggtaccaatccgcgatatccgctgatgagcgaaataaggcaaatg
tatctgaatgcttattacggcaaaaaacattttgtcgatgaagaaaagccaaatgaagcg
gatatcgccgggacagaggatgaaaacaaagttaaaaaggcgtatctgagagccagagtc
ggagcgaagagagcatga

DBGET integrated database retrieval system