KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c20160Help
Entry
Cst_c20160        CDS       T02440                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cst_c20160 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cst_c20160 (trpC)
Enzymes [BR:css01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cst_c20160 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2191470..2192294)
Genome map
AA seq 274 aa AA seqDB search
MFLEKLVKSAEMRVETAKKRVSPDELKSRVLNTDGNKKFYRREDFAFEKSLKKEGISFIC
ELKKASPSKGILDSSFPYLEIAENYEKAGADAVSVLTEPEYFMGSDDYLKEISARINIPV
LRKDFIVDEYQIYEAKLIGADAVLLICALLDTRTIKKYIEICDILGISALVEAHTEEEIR
SALEAGARVIGVNNRDLRTFEVDIRKCIDLRKFVPENVIFVAESGIKTRDDILMLEQAKV
DAVLIGETLMRSRDKKAMLAYLKGETKQIPEELK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaagctggtaaaatcagccgaaatgcgcgttgaaaccgcaaaaaaaaga
gtatcgccggatgaactgaaatcaagggttttaaacacagatgggaataaaaagttttac
aggcgggaagatttcgcctttgagaaaagtttgaaaaaagaaggaatctcatttatttgc
gagttaaaaaaagcttcaccgtcgaagggaattttagattcttcttttccataccttgaa
atcgcggagaattatgaaaaggccggagccgatgccgtatcggttcttacggaacctgaa
tatttcatgggaagtgatgactatcttaaagaaataagtgcacgcataaacattcccgta
ctgcgcaaggactttattgttgatgagtatcagatttacgaggcaaaattaataggtgca
gatgcggtattgttaatctgtgccctgcttgatacccggacaattaaaaaatacatagaa
atatgcgatatacttggcatttcggctttggtggaagcccataccgaggaagaaataagg
tcggcacttgaagcgggcgcaagggtgattggcgtaaacaacagggatttaagaaccttt
gaagtggatatccggaaatgtattgatttaaggaagtttgttcctgaaaacgtcatattt
gtagccgaaagcgggattaaaacacgcgatgacatattgatgcttgagcaggcaaaggtt
gatgcggttctgattggggaaacgcttatgaggagcagggacaaaaaagccatgcttgca
tacctgaaaggggaaaccaaacagataccggaggagttaaaatga

DBGET integrated database retrieval system