KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c23070Help
Entry
Cst_c23070        CDS       T02440                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase FucA (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:css00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2499228..2500517)
Genome map
AA seq 429 aa AA seqDB search
MKFELLHPAEQIVMIMERIYGYGMTTTSGGNLSIKDENGDVWITPAGIDKGSLTTKDIVQ
VKPDGTIIGKHKPSSELPFHLSTYKQRPDVGAVLHAHSPALVSFSIVRKIPDTRLIPDVN
LICGEVGMAEYGLPGSDELGEKIAKVLRQGINTVLLENHGAVVVGKDLFQAFMAFETLDF
SARLEINARRIGNPVSLTPRYVEISKQKRHVEMEEFVPKGYSSYERLVRKEMCDLIHRAY
NQRLFTSTQGTFSTRLDENSFVITPYNVDRKYIDVDQLVRIENGRKEAGKTPSRSVLLHK
YIYEKHPHVNSIIIAHPFNIMTFAVTDVPFDSRTIPESYILLRDIPKIPFGSSFMQPAMV
ADLFVPQTPIVLVENDCVIVTGNSLLNAYDRLEVAEFSAKALIAAKSIGNVVEINDQQID
DLKKAFHLD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaattgctgcatccggcggaacagattgttatgataatggaaaggatttat
gggtacgggatgaccacgacatcaggagggaatttatcaattaaggacgaaaacggagat
gtttggataacccctgccggtatagacaagggttcacttacaacaaaggacattgtccag
gtgaaacccgacggaacaatcatcggaaaacacaagccttccagcgagcttccgtttcat
ctttccacatataagcaaagacccgatgtcggcgcggttctgcacgcccattcgcctgcg
ctggtatctttcagtattgtaagaaaaattcctgatacaaggctcatacccgatgttaat
cttatctgcggggaagttggtatggctgagtatggtcttcccggaagtgatgagctcggc
gaaaaaattgcaaaagtactgaggcagggaataaacacggtattgcttgaaaatcacggc
gcagttgtggtgggaaaggatctgttccaggcatttatggcatttgagacccttgatttc
agtgcgcgcctggaaataaacgcccggagaataggaaatcctgtttcgcttactccaaga
tatgtggaaatttcaaagcaaaagagacatgttgaaatggaggaatttgtcccgaaaggc
tacagcagttacgaaaggcttgtaagaaaggaaatgtgcgatcttatacacagggcttac
aatcaaaggctgttcaccagcactcaggggacattctccacacgtcttgatgaaaactct
tttgtcattactccttacaacgtggatcgcaaatacatcgacgttgatcagcttgtacgc
atagaaaacggcaggaaggaagctggaaaaactccgagccgttcggttttgttgcataag
tatatatatgaaaagcatccccacgttaactcgattataattgctcacccgttcaatata
atgacgtttgcggttacagacgtgcctttcgattcaaggaccatacccgaaagctatatt
ctgctcagggatattcctaaaataccgtttggctcaagttttatgcagcccgcaatggtg
gcagatttatttgtgccacagacaccgatagtccttgtggagaatgactgtgtcattgta
acgggaaactcgctgctgaatgcgtatgacaggcttgaggttgcggaattcagcgctaaa
gccctgattgccgcaaaaagcatagggaatgttgttgaaatcaatgatcagcagattgat
gacttgaaaaaagcttttcatcttgattga

DBGET integrated database retrieval system