KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c26500Help
Entry
Cst_c26500        CDS       T02440                                 

Gene name
pemA
Definition
pectinesterase A (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:css00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:css00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2825771..2826748)
Genome map
AA seq 325 aa AA seqDB search
MIVAADGSGDYLSLGQALQALENMKDSGERVVIHIKKGIYREKLHISRPNVTLIGEDAES
TVITYDDYARKRFENGEEYGTFNSYTVLITGDGFEARNLTIENAAGSGTIKGQALAAYVD
ADRAVFRNCRFLGHQDTLFTAPLPPAPIIKNGFKGPGEHRERKMQSHYYENCYIEGDVDF
IFGSATAVFKNCTIVSLDRGEPEGGVNGYITAASTPEGVKYGYVFINCRLLGKCKPSTVY
LGRPWRNFARTVFINCYMDDHIKSEGWHNWDKPESESTVFYAEYNSYGPGARPDKRVQWA
KILTDEEAKEYTIEKILPWLSGRQE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgcagcggacggaagcggagattatctttcgctgggacaggccttgcaggca
ctggaaaatatgaaagacagcggcgaaagagttgtaattcatattaagaaaggaatatac
agggagaaacttcacataagcaggcccaatgtcacactgattggggaagacgccgaatca
acggtgattacttacgacgactatgcaaggaagaggtttgaaaacggcgaagaatacggt
acgtttaattcatataccgttcttattactggcgacggatttgaagcgcgcaacctgact
attgaaaacgcggcaggatcgggtacaataaagggacaagcccttgcagcttacgtggat
gccgaccgtgcagtgttccggaactgccgttttttggggcatcaggatactctcttcaca
gcaccgctgcccccggcgcctattataaaaaacggatttaaagggccgggtgagcacaga
gaaagaaaaatgcagagtcactattatgaaaactgctatattgaaggcgatgtggatttt
atattcggctcggcaacagcggttttcaagaactgtactattgtgtcgctggacaggggt
gaaccagaaggcggcgtaaacggatatattacggccgcgtccacgcctgaaggcgtgaaa
tacggttatgtttttattaactgcaggcttctgggcaaatgcaaaccgtccaccgtgtat
ctcggcagaccgtggaggaattttgcgagaaccgtttttataaattgctatatggatgat
catattaaaagtgaaggctggcataactgggataaacctgaaagcgaatccaccgttttt
tatgccgagtataacagctacgggcccggggcccggcccgataaaagggttcagtgggca
aaaatacttaccgatgaagaggcaaaggaatataccattgaaaaaatcctgccgtggctg
agcggcagacaggaatga

DBGET integrated database retrieval system