KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c27580Help
Entry
Cst_c27580        CDS       T02440                                 

Gene name
murA3
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 3 (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cst_c27580 (murA3)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cst_c27580 (murA3)
Enzymes [BR:css01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cst_c27580 (murA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2946592..2947848)
Genome map
AA seq 418 aa AA seqDB search
MEKLVICGQKRLEGEVCVSGAKNAAVAILPATILSDGKCTIENVPDILDVAILKEILKEL
GASINQINDSSIQIDTSNINSYVANNSQIGKLRASYYLMGALLGRFKKAIVPFPGGCDFG
VRPIDQHIKGFEALGAKVEIEHGKVIISAEKLVGAPVYLDVVSVGATVNIMLAAVKAEGV
TTIENAAKEPHIVDLANFLNAMGADIKGAGTDVIKIRGKKHLKGGHTYTIIPDQIEAGTY
MIAAAATNGDVLVKNIIPKHMESLTAKLQEMNVTVDVYDDSIRVRGSDKIQKVNIKTLPY
PGFPTDLQPPVTSLLCRAEGTSIITEGVWDNRFQYVDELKRMGAKIKVEGRTAVIEGPVR
LTGAPVRAMDLRAGAAMVIAGLMAHGETVISNIHYIDRGYERLDEKLRSLGADIQRIK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaactggtgatttgtggccaaaaaaggcttgaaggtgaagtttgtgtcagtgga
gcaaagaatgctgcagtggcaatactccctgcgacaattttatcggatggaaagtgtaca
attgaaaatgttcctgatatattggacgtagctattttaaaagaaatattgaaagagttg
ggagccagcattaatcagataaatgattcttcaattcagatagatacgtcaaatattaat
tcctatgtagcaaacaacagtcagattggcaagcttcgtgcttcatattacctgatggga
gcacttctcggaagatttaaaaaagcaattgttccttttccgggcggatgtgatttcggt
gtaagaccaatcgatcagcatataaagggattcgaggctttgggggcgaaagttgagata
gagcacggaaaggtgataataagtgccgaaaagcttgtaggtgcgcctgtatatcttgac
gttgtaagcgtaggagcaacggtaaacattatgcttgctgctgtgaaggccgaaggcgta
actacaatagaaaacgcagcaaaagagcctcatattgtggatctcgcgaactttttaaat
gccatgggcgcggatataaaaggtgcaggcaccgatgttataaagataaggggaaagaag
catctgaaaggcgggcacacgtatacaataattcctgatcagatagaagccggtacttat
atgattgcagcggcagccacaaacggagacgttttggtgaaaaacattattccgaaacat
atggaatcactgacggcaaaactgcaagaaatgaatgtaacggtggatgtgtacgatgac
agtatccgagttcgtggaagtgacaaaattcagaaagtcaatataaaaacacttccttat
cctggattcccgaccgaccttcagccacctgtcacttcactgctgtgccgcgctgaaggt
acaagtatcatcaccgaaggagtctgggataaccggttccagtatgtggatgaattgaaa
agaatgggagcgaaaattaaagttgaaggtcgtaccgcggtaatagaagggcctgtacgc
ctgactggcgcgccggtcagggcaatggatctgagggccggggcggcaatggtgattgcc
ggtttgatggctcacggggaaacggtgatttcgaatattcattacattgacaggggatat
gaaagattggatgaaaagttaagatcactgggagccgacatacaaaggataaagtag

DBGET integrated database retrieval system