KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c27580Help
Entry
Cst_c27580        CDS       T02440                                 

Gene name
murA3
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 3 (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:css00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:css00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2946592..2947848)
Genome map
AA seq 418 aa AA seqDB search
MEKLVICGQKRLEGEVCVSGAKNAAVAILPATILSDGKCTIENVPDILDVAILKEILKEL
GASINQINDSSIQIDTSNINSYVANNSQIGKLRASYYLMGALLGRFKKAIVPFPGGCDFG
VRPIDQHIKGFEALGAKVEIEHGKVIISAEKLVGAPVYLDVVSVGATVNIMLAAVKAEGV
TTIENAAKEPHIVDLANFLNAMGADIKGAGTDVIKIRGKKHLKGGHTYTIIPDQIEAGTY
MIAAAATNGDVLVKNIIPKHMESLTAKLQEMNVTVDVYDDSIRVRGSDKIQKVNIKTLPY
PGFPTDLQPPVTSLLCRAEGTSIITEGVWDNRFQYVDELKRMGAKIKVEGRTAVIEGPVR
LTGAPVRAMDLRAGAAMVIAGLMAHGETVISNIHYIDRGYERLDEKLRSLGADIQRIK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaactggtgatttgtggccaaaaaaggcttgaaggtgaagtttgtgtcagtgga
gcaaagaatgctgcagtggcaatactccctgcgacaattttatcggatggaaagtgtaca
attgaaaatgttcctgatatattggacgtagctattttaaaagaaatattgaaagagttg
ggagccagcattaatcagataaatgattcttcaattcagatagatacgtcaaatattaat
tcctatgtagcaaacaacagtcagattggcaagcttcgtgcttcatattacctgatggga
gcacttctcggaagatttaaaaaagcaattgttccttttccgggcggatgtgatttcggt
gtaagaccaatcgatcagcatataaagggattcgaggctttgggggcgaaagttgagata
gagcacggaaaggtgataataagtgccgaaaagcttgtaggtgcgcctgtatatcttgac
gttgtaagcgtaggagcaacggtaaacattatgcttgctgctgtgaaggccgaaggcgta
actacaatagaaaacgcagcaaaagagcctcatattgtggatctcgcgaactttttaaat
gccatgggcgcggatataaaaggtgcaggcaccgatgttataaagataaggggaaagaag
catctgaaaggcgggcacacgtatacaataattcctgatcagatagaagccggtacttat
atgattgcagcggcagccacaaacggagacgttttggtgaaaaacattattccgaaacat
atggaatcactgacggcaaaactgcaagaaatgaatgtaacggtggatgtgtacgatgac
agtatccgagttcgtggaagtgacaaaattcagaaagtcaatataaaaacacttccttat
cctggattcccgaccgaccttcagccacctgtcacttcactgctgtgccgcgctgaaggt
acaagtatcatcaccgaaggagtctgggataaccggttccagtatgtggatgaattgaaa
agaatgggagcgaaaattaaagttgaaggtcgtaccgcggtaatagaagggcctgtacgc
ctgactggcgcgccggtcagggcaatggatctgagggccggggcggcaatggtgattgcc
ggtttgatggctcacggggaaacggtgatttcgaatattcattacattgacaggggatat
gaaagattggatgaaaagttaagatcactgggagccgacatacaaaggataaagtag

DBGET integrated database retrieval system