KEGG   Clostridium sticklandii: CLOST_0041Help
Entry
CLOST_0041        CDS       T01334                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cst  Clostridium sticklandii
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cst00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(56308..57159)
Genome map
AA seq 283 aa AA seqDB search
MNKNIFTFIGFDNEFEESQIVLFGAPFDGTTSFRPGTRFAPNIMRNDSFGLETYSPYLNK
DLEDYMLFDSGDLDFPFGNPQRIIDMIKEHSKAIVNTGKIPFMIGGEHLVTLGSVQSVYE
KYNDLHIIHLDAHADLREDYMGQKLSHATVLRRCHDFLGDGRIHQFGIRSGTKEEFTWAK
DHVDMHPFSLDGLKEVIDELKDKPVYITIDLDVLDPSIFPGTGTIEPGGISFLELVGAFK
EFSRLNNIVGMDAVELSPHYDQSGMSTAVACKVIREMALIAVK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaatatttttacctttataggttttgataatgaatttgaagagtctcagata
gtattatttggggctccttttgacggtactacatcttttagacctggtactcgttttgct
cctaacatcatgagaaacgactcctttggactagaaacttacagtccttacttaaacaag
gatttagaagattatatgctgtttgattctggagatttagatttcccttttggaaatcct
caaagaatcatagatatgataaaagagcattctaaggctatagtaaatacaggtaagatt
ccttttatgataggtggagagcatttagttaccctaggaagcgtacaaagcgtatatgaa
aagtacaatgaccttcatatcatccacttagacgcacatgctgatttaagagaggattac
atgggccaaaagctttctcacgctacagttctaagacgttgtcacgattttttaggtgat
ggaagaattcatcagtttggaattcgctctggaacaaaggaagaatttacttgggcaaaa
gaccacgtggatatgcatccattttcattagatggcttaaaagaagttattgatgaatta
aaagacaagcctgtttatataactatagatttggacgtattagacccttcaatctttcct
ggcactggaactatagagccagggggaataagcttcttagagcttgtaggagcttttaaa
gagttttcaagacttaataacatcgtaggcatggatgcagtagagctgtctcctcactac
gaccaaagtggcatgtctacagccgtagcatgcaaggttataagagaaatggcattaata
gctgtaaagtag

DBGET integrated database retrieval system