KEGG   Clostridium sticklandii: CLOST_0110Help
Entry
CLOST_0110        CDS       T01334                                 

Gene name
recR
Definition
gap repair protein
Orthology
K06187  
recombination protein RecR
Organism
cst  Clostridium sticklandii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cst03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
132959..133561
Genome map
AA seq 200 aa AA seqDB search
MDYYSGPISRLIEEFAKLPGVGRKTAQRLAFHVINMDKDQVKALAHAIVEAKNNITYCST
CCNIADKNPCSICDSPNRTSDIICVVEDPRDVAAMERTKEFHGKYHVLHGTISPMDSITP
DMLKIKELVGRMANPELKEVILATNPTIEGEATAMYIARLIKPFNIKVTRIAHGLPVGAD
IEYADEVTITKALEGRREIF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtggattattactcaggacccatcagcagactgattgaggaatttgcaaagctgcctggg
gtaggtagaaaaacagcgcaaagactagcttttcacgttataaatatggacaaagaccaa
gtaaaagcactggctcatgctatagtagaagcaaaaaacaacataacctactgctctacc
tgctgtaacatagcagacaaaaatccttgcagtatctgtgattctcctaatcgtacctct
gatatcatttgtgtggttgaagatccaagagacgtagccgcaatggagagaacaaaagaa
tttcatggaaaatatcacgtgcttcacggcaccatatcacctatggactctattactcca
gatatgctaaaaataaaggaactagtaggaagaatggcaaacccagagctaaaagaagta
atactagcaacgaatcctaccatagagggcgaagctacagctatgtatatagctagactt
ataaagccatttaacataaaagttactcgtatagcacatggactcccagtaggagctgac
atagaatacgcagatgaagtgactataacaaaagcgttagaaggaagacgagagattttt
taa

DBGET integrated database retrieval system