KEGG   Clostridium sticklandii: CLOST_0360Help
Entry
CLOST_0360        CDS       T01334                                 

Gene name
asnB
Definition
Asparagine synthase (Glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cst  Clostridium sticklandii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLOST_0360 (asnB)
Enzymes [BR:cst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CLOST_0360 (asnB)
Peptidases [BR:cst01002]
 Cysteine Peptidases
  Family C44
   CLOST_0360 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419102..420919
Genome map
AA seq 605 aa AA seqDB search
MCGIVGQFSIDEKTNLLSKTEELSKMLESMIHRGPDGEGKYESKNLIMGMRRLSILDLDN
GFQPIFNEDKSIVVVFNGEIYNYIEIKDELLKKGHKFYTSSDTEVLVHLYEEYGEDFSSY
LNGMFSYTLFDIKNNVLIVSRDRVGEKPLYYSIMNDIFYFSSEIKSLLLCSDIKCEANKD
SINDMLTFNYVPYPNTAFKNIYRLEPGKSIIIKNNKISKKTYWEIPKKSIYNNNFENFET
LDSLISNSVEIRMRSDVEVGAFLSGGIDSTIVTKYMREKTEDSFKTFSIGFTEEIYNELD
YAKKVSETYNTNHIYKIVNQDDFLEQLVNSIWFCENPHGDVSFAPTFILSELASKYLKVV
LTGDGGDEIFGGYDKYLDFIYNQELDINENFKNYFNKISVFNILEKESILSNEFKSDLIE
IDSFKKIEEKYIGIHNSDFINKIMYFDSDYLLEGNNLVKPDRMGMANSIEGRYPLLDYRI
IEMMFNIDSSKKIYNGEKKYLLKNILSKDFDDDFIKRKKQMFTVPIGEWFKDKEFIDKIN
PIICSEKFKNRGVFNYDRVLKMIQSHQNSQENYTRQLRAILVVELWYRIYIDNKFTKKPS
FNDLI
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgtaggtcaattttcaattgatgagaaaactaacttattaagcaagact
gaagaattaagcaagatgttagaatctatgattcatagaggaccagatggagaaggaaaa
tatgagtctaaaaatttaattatggggatgagaaggttaagtattttagatttagataat
ggatttcagccaatatttaatgaagataaatctattgttgtagtatttaatggagaaatt
tataactatattgaaattaaagatgaattattaaaaaaagggcataagttttatacctct
agtgatacagaagtgttagtgcatttatacgaagaatatggagaagatttttcgagttac
ttaaatggaatgttttcatatacactttttgatattaaaaataatgttctaattgtttct
agagacagagtaggtgagaaaccattatactattctataatgaatgatattttttatttt
tcatctgaaataaaatctctattattatgcagtgatataaagtgtgaagcgaataaagat
tctattaatgatatgctaacttttaattatgttccataccctaatacagcatttaaaaat
atttatagattagagcctgggaagagcatcataattaaaaataataaaatatcaaaaaaa
acatattgggaaattcctaaaaagtctatatataataataactttgaaaattttgaaacc
ttagattcacttatttctaacagtgttgaaataaggatgagaagtgatgtagaggtagga
gcttttttaagtggagggattgactcaactatagtaacaaaatacatgagagagaaaaca
gaagattcgtttaaaaccttttcaattggtttcactgaagaaatctataatgagttagat
tatgcaaaaaaagtatcggaaacatataacacaaaccatatttataagatagttaatcaa
gatgattttttagagcaattagttaactctatatggttttgtgaaaatcctcacggagat
gtatcttttgcgcctacatttattttatcagaattagcatcaaaatatttaaaggtagtt
cttactggtgatgggggagatgaaatttttggaggatatgataagtatttggattttatc
tataatcaggaattagatataaatgaaaattttaaaaattattttaataaaattagtgtt
tttaatattttagaaaaagaatcgattttgtctaacgagtttaagtctgatttaattgag
attgattcttttaaaaaaattgaagaaaaatatataggaattcataattcggatttcata
aataaaataatgtattttgattcagactatttgttagaaggaaataatttagtgaaacct
gatagaatgggtatggctaactcaattgagggaagataccccttgttagattatagaata
attgaaatgatgtttaacatagattctagtaagaaaatctacaacggagaaaaaaaatat
ttacttaaaaatattctttctaaagattttgatgatgactttataaaaaggaagaaacaa
atgtttacagtaccaattggtgaatggttcaaagataaggagtttattgataaaattaat
ccaattatatgttcagagaagtttaaaaatagaggggtatttaattatgacagagtttta
aaaatgattcaatcacatcaaaatagccaggaaaactatactagacagcttagagctata
ttagttgtagagttatggtacagaatatatattgataataaatttactaaaaaaccatca
tttaatgatcttatatag

DBGET integrated database retrieval system