KEGG   Clostridium sticklandii: CLOST_0460Help
Entry
CLOST_0460        CDS       T01334                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cst  Clostridium sticklandii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLOST_0460 (galU)
   00052 Galactose metabolism
    CLOST_0460 (galU)
   00500 Starch and sucrose metabolism
    CLOST_0460 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CLOST_0460 (galU)
Enzymes [BR:cst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLOST_0460 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538927..539802
Genome map
AA seq 291 aa AA seqDB search
MQTVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIKEILIITGRN
KKSIEDHFDKSVELELELEHKGKLDLLEMVRNISNMINIHYIRQKEPNGLGHAIHCAKSF
IGDEPFAVMLGDDVVDAEKPCLKQLIEAYEEYHTTILGVQQVANEDVNKYGIVDGRYIED
GIYKVKDLIEKPDIETAPSNIAILGRYIITPEIFDILENTKPGKNGEIQLTDGLKTLCKN
QAMYAYVFEGKRYDVGDKLGFLEATVDFALKNPELRDGFLEYMKKTVSSNM
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagactgtgaagaaagctataataccggctgcgggacttgggactagatttttacct
gcgactaaagcacagccaaaggaaatgctccctatagttgataagccaaccctgcaatat
ataatagaagaagcagtagcttcaggtataaaagagattcttatcattactggaagaaat
aaaaaatcaatagaagatcattttgataaatctgtggaattagagctagaattagaacat
aaaggaaaactagatttacttgaaatggttagaaatataagcaatatgattaatatacat
tatataaggcaaaaagagcctaatggattagggcacgcgattcactgcgctaagagcttt
ataggggatgagccatttgctgttatgcttggcgacgatgtagtagatgcagagaaacca
tgtctaaagcagcttatagaagcctacgaggaataccatactacgattttaggagtacag
caggtagcaaatgaggatgtgaataagtatggtattgttgatggaagatatatagaagat
ggtatatataaagttaaggatttaatagaaaaaccagatatagaaaccgcaccatcaaat
atagcaatccttggaagatatataataactccagaaatatttgatatattagaaaataca
aagccaggcaaaaatggagaaattcagcttaccgatggattaaagactttgtgcaagaat
caagctatgtatgcctatgtatttgaaggcaagcgctatgacgttggagacaaactaggt
ttcttagaagctactgttgactttgcactaaagaaccctgagcttagagatgggttttta
gaatatatgaaaaaaaccgttagcagcaatatgtaa

DBGET integrated database retrieval system