KEGG   Clostridium sticklandii: CLOST_0521Help
Entry
CLOST_0521        CDS       T01334                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase and histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cst  Clostridium sticklandii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cst01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cst00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626174..627448
Genome map
AA seq 424 aa AA seqDB search
MNIFKLNSERARAFLNKISSRQADMEDKVLDAVREIINKVKQNGDNALISYAKQFDKVEL
KSLEVSSIELSQTELKIDKAVKKAIDKAYENIWEFQSAQKPEDFIYEKEGIISKTRYIPI
ETAGIYVPGGKAAYPSSVLMNAIPARAAGVKNIIMTVPCDENGVISPEVLYAAKLCKVDR
IFKVGGAQAIAALAYGTESIPKVDIITGPGNIYVSVAKKLVYGTVNVDMIAGPSEILIVS
DGNQNPSYIAADLISQAEHDELASSILLTLSDKEAEAVSNEVGIQLSKLPKSKIASESIK
NYGAILVCDTKQELIDIANQIAPEHLEVLFEDKKITDSLTNAGCIFSGEYSPEPLGDYMA
GPNHILPTNGSAKAFSPLGIQSFMKRSNYIEASKEGLEKIYKDIACFAKAENLDGHANSI
LRRF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatatttaagctaaattctgaaagagcaagagctttcctaaataaaataagctct
aggcaagcagatatggaagataaggtgctagatgcagttagagaaataataaataaggta
aaacaaaacggtgataatgcattgataagctatgcaaagcagtttgacaaggtagagtta
aaaagcctagaggtaagcagtatagagctaagtcagaccgaactgaaaattgataaagct
gttaaaaaagctatagataaggcatatgagaatatatgggaatttcagtcagctcaaaag
cctgaggattttatttacgaaaaggaaggaatcatatctaaaactagatatatacctata
gaaacagcaggaatctatgtcccagggggcaaggcagcctatccatcatccgtacttatg
aatgccataccagcaagagctgctggggttaaaaatatcattatgacagtgccttgcgat
gaaaatggagtgataagccctgaagtgctttatgcggccaagctttgcaaggtagataga
atattcaaggtcggaggagcacaggcaattgctgctcttgcatatggcacagagtctatt
ccaaaggtagatatcattacaggaccaggaaatatctatgtatcagttgcaaaaaaattg
gtttatggaactgtaaatgtagatatgatagctggacctagtgaaattctaatagtatca
gatggaaatcaaaatccaagctatatagcggcagatttgatttcacaggcagagcatgat
gagctggcatcatctatactactaactctaagcgataaagaagcagaggctgtatcaaat
gaagtgggcattcagctatcaaagctcccaaaatctaaaattgcatctgaatcaattaaa
aactatggagcgattctagtatgtgatactaagcaggaactcatagatatagctaatcaa
atagctccagagcatcttgaggttttgtttgaagataaaaaaattactgacagccttaca
aatgctggatgtattttttcaggagaatactcgccagagccactaggggattacatggct
gggccaaaccacatacttccaaccaatggaagcgctaaagctttttcgcctctagggatt
caaagctttatgaaaagaagtaactatatagaagcaagcaaagaagggcttgaaaaaatt
tataaggatatagcctgttttgcaaaggcagaaaatttagatggacatgcaaattcgatt
ttgaggaggttttaa

DBGET integrated database retrieval system