KEGG   Clostridium sticklandii: CLOST_0644Help
Entry
CLOST_0644        CDS       T01334                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cst  Clostridium sticklandii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLOST_0644 (tpiA)
   01230 Biosynthesis of amino acids
    CLOST_0644 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_0644 (tpiA)
   00051 Fructose and mannose metabolism
    CLOST_0644 (tpiA)
   00562 Inositol phosphate metabolism
    CLOST_0644 (tpiA)
Enzymes [BR:cst01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLOST_0644 (tpiA)
Exosome [BR:cst04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLOST_0644 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLOST_0644 (tpiA)
  Exosomal proteins of melanoma cells
   CLOST_0644 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
763285..764031
Genome map
AA seq 248 aa AA seqDB search
MRKPIIAGNWKMHKTIAEALEFVEKIKAEVAGTDVETVICAPFTQLKDIKQAVKDTNIKV
GAQNMHYEEKGAFTGEISAAMLKELMVDYVIIGHSERRQYFNETDETVNKKVKKALAYDI
TPIMCVGESLEEREAEKTKEIVKDQTMKGLEGLTNEQVSSLVIAYEPIWAIGTGKTASSQ
DANEVIAYIREVVKDMYSEEVSEEVRIQYGGSVKPSNVEEIMNESDIDGALVGGASLEAS
DFTALVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacctataatagctggaaattggaaaatgcataaaacaatagccgaggcgctt
gagtttgtagaaaaaattaaagctgaggttgctggaacggatgtagagacagttatttgc
gctccatttacacagctaaaggatataaaacaagcagtaaaggatacgaacatcaaagta
ggagctcaaaacatgcattatgaggaaaaaggagcttttactggtgaaatatcagcagct
atgctaaaagaactaatggtagattatgtaataataggacattcagagagaagacagtat
tttaatgagacagatgaaactgtcaataaaaaagtaaaaaaggctttagcttatgatata
actccaatcatgtgcgtaggagagtctttagaggaaagagaagcagaaaaaactaaagaa
atagtaaaagaccaaacgatgaaaggcctagaaggacttactaatgagcaggtctcatct
cttgtcatagcctatgagcctatttgggctataggtacaggaaaaactgcatctagccaa
gatgcaaacgaagtaattgcttatatcagagaggttgtaaaagacatgtactctgaggaa
gtatctgaggaagttcgtattcagtatggaggcagtgttaagccttcgaatgttgaagag
attatgaatgaaagtgatattgacggagcacttgtgggaggagcctcattagaagcctct
gattttactgctttagtcaatttttaa

DBGET integrated database retrieval system