KEGG   Acetoanaerobium sticklandii: CLOST_0753Help
Entry
CLOST_0753        CDS       T01334                                 

Gene name
porC
Definition
(GenBank) Pyruvate synthase subunit porC (Pyruvate oxidoreductase gamma chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit gamma)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
cst  Acetoanaerobium sticklandii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_0753 (porC)
   00020 Citrate cycle (TCA cycle)
    CLOST_0753 (porC)
   00620 Pyruvate metabolism
    CLOST_0753 (porC)
   00640 Propanoate metabolism
    CLOST_0753 (porC)
   00650 Butanoate metabolism
    CLOST_0753 (porC)
  Energy metabolism
   00680 Methane metabolism
    CLOST_0753 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CLOST_0753 (porC)
Enzymes [BR:cst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CLOST_0753 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
887899..888435
Genome map
AA seq 178 aa AA seqDB search
MKEIRFHGRGGQGVVKSAQIIVQTVVESGLYGQFIPFFGVERKGSPVFGFLRIDDSEIRV
KCQVYNPEVLMIFDDTLLKMPQTFAGLEENAIVIINTTKNIEDLNLPDIKMKVYTVDATG
IALETIEKDIPNTAMLGAFAKATELVNWYILKDKIKLAFNEDNVMSAQLAFERVKLSK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagattcgatttcatgggcgtggaggtcaaggtgtagtaaaatcagctcaaata
atagttcagacagtagttgaatctggactctatggtcagttcattcctttttttggagta
gagagaaaaggttctccagtgtttggatttttgcgcattgatgattctgaaattagagta
aagtgccaagtttataatccagaggtactgatgatttttgatgataccttattaaaaatg
cctcagacttttgctggattagaagaaaatgcaattgtaatcataaatactactaaaaat
attgaagatcttaatttaccagatataaaaatgaaagtatatacagttgatgccactggt
atagcacttgagactatagaaaaggatatcccaaatacagctatgctaggagcttttgca
aaggctacagaactagtgaattggtatattctaaaagacaaaattaagcttgcatttaac
gaagacaatgttatgtcagctcagcttgcttttgaaagggtaaagctatctaaatag

DBGET integrated database retrieval system