KEGG   Clostridium sticklandii: CLOST_0754Help
Entry
CLOST_0754        CDS       T01334                                 

Definition
Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit (modular protein)
Organism
cst  Clostridium sticklandii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888460..888720
Genome map
AA seq 86 aa AA seqDB search
MSRNFITPIGDEGIYTLDTGSWRTFRPIMNKDNCVECGICMSFCPVGSITGNKQKIYAID
YKFCKGCGICAYECPSKAIDMVKEGD
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggaattttataactccaataggagatgaaggtatatatacgcttgatactgga
agctggagaacttttagaccgattatgaataaggataattgtgtagagtgcggaatatgt
atgagcttttgcccagtaggaagcatcactggaaataagcaaaaaatatatgctatagat
tataaattttgcaagggttgtggaatctgtgcttatgaatgtccatcaaaagcaatagat
atggtaaaggaaggggattaa

DBGET integrated database retrieval system