KEGG   Clostridium sticklandii: CLOST_0754Help
Entry
CLOST_0754        CDS       T01334                                 

Definition
(RefSeq) Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit (modular protein)
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cst  Clostridium sticklandii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLOST_0754
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_0754
   00020 Citrate cycle (TCA cycle)
    CLOST_0754
   00620 Pyruvate metabolism
    CLOST_0754
   00640 Propanoate metabolism
    CLOST_0754
   00650 Butanoate metabolism
    CLOST_0754
  Energy metabolism
   00680 Methane metabolism
    CLOST_0754
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CLOST_0754
Enzymes [BR:cst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CLOST_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888460..888720
Genome map
AA seq 86 aa AA seqDB search
MSRNFITPIGDEGIYTLDTGSWRTFRPIMNKDNCVECGICMSFCPVGSITGNKQKIYAID
YKFCKGCGICAYECPSKAIDMVKEGD
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggaattttataactccaataggagatgaaggtatatatacgcttgatactgga
agctggagaacttttagaccgattatgaataaggataattgtgtagagtgcggaatatgt
atgagcttttgcccagtaggaagcatcactggaaataagcaaaaaatatatgctatagat
tataaattttgcaagggttgtggaatctgtgcttatgaatgtccatcaaaagcaatagat
atggtaaaggaaggggattaa

DBGET integrated database retrieval system