KEGG   Acetoanaerobium sticklandii: CLOST_0755Help
Entry
CLOST_0755        CDS       T01334                                 

Gene name
porA
Definition
(GenBank) Pyruvate synthase subunit porA (Pyruvate oxidoreductase alpha chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit alpha) (EC:1.2.7.1)
Organism
cst  Acetoanaerobium sticklandii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
888722..889903
Genome map
AA seq 393 aa AA seqDB search
MDKNKIVAISGNKSAAIGAALSKPDLIAAYPITPQSSVVEALADMIAKGELDSNMVHVES
EHSAMSVVQGATVAGGRTFTATSAQGLALMFEPYFRMSTLRLPMVMAIATREMTSPETVW
SGQQDAVTVRDAGWIQMFAENNQEILDMVIQGYKLAEHKDVLLPVNVCYDGFYLSHLTER
FEIPRQELADEFLESYSCNHVTLDPDKPMAVDPLTSSEILWRYRKSHLEAMQNALEVIDE
VDIEFDKVFGRKYGGAIDTYKIDDAELVIVTMGATTGTARVAVDKARDMGYKIGLLKVRF
LRPFPSQKIKEVLNSKKAYAVIDKSVSFGWNTGVLYNEIKSAVSDLGRAITSMPAIGGLG
GADISVDMLLDCIKKLDEESKNYNGQLATYWFE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataagaataagattgtagctataagtggtaataaatcagctgcaataggagcagca
ctttcaaaacctgatttgattgcagcatatcctattactcctcagtcttctgtagtagag
gctctagctgacatgatagcaaaaggcgagcttgattcaaatatggtacatgtggaatct
gaacattctgccatgagtgtagttcaaggagctactgttgctggaggaagaacgtttaca
gctacttcagctcaaggtctggcgcttatgtttgagccttattttagaatgtctacttta
agacttcccatggttatggcaatagcaactagagaaatgacatctccagaaactgtatgg
agtggacagcaggatgcagttactgtaagagatgctgggtggatacagatgtttgccgaa
aacaatcaagagattttagatatggtaatacaaggatataagcttgccgaacataaagat
gtattgcttccagtaaatgtctgttatgacggcttctatttatctcacttaacagaacga
ttcgagattcctagacaagaattagcagatgaatttctagaaagctatagctgtaaccat
gtaactcttgaccctgataagccaatggcagtagatcctctaacttcttctgaaattttg
tggagatatagaaagagccatttagaagctatgcaaaatgcattagaagtcatagacgaa
gtggatatagagtttgataaagtatttggaagaaaatatggaggagctatagacacctac
aagatagatgatgccgagcttgttatagttactatgggagctactactggtacagcaaga
gtggcagtagataaagcaagagatatgggctataagatagggttattaaaagtaagattt
ttaagaccatttcctagtcaaaaaatcaaagaagtgttaaatagtaaaaaagcatatgct
gtaattgacaaaagtgtaagttttggctggaacacaggagttttatacaatgaaattaaa
tcggcagtgtctgatttaggccgagctattactagtatgccagcaattggaggactagga
ggagcggatatttctgtagatatgttactggactgtattaagaagttggatgaggaaagt
aaaaattataatggacagttagccacctattggtttgagtga

DBGET integrated database retrieval system