KEGG   Clostridium sticklandii: CLOST_0755Help
Entry
CLOST_0755        CDS       T01334                                 

Gene name
porA
Definition
Pyruvate synthase subunit porA (Pyruvate oxidoreductase alpha chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit alpha) (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
cst  Clostridium sticklandii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:cst01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cst00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cst00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cst00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cst00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cst00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:cst00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:cst00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888722..889903
Genome map
AA seq 393 aa AA seqDB search
MDKNKIVAISGNKSAAIGAALSKPDLIAAYPITPQSSVVEALADMIAKGELDSNMVHVES
EHSAMSVVQGATVAGGRTFTATSAQGLALMFEPYFRMSTLRLPMVMAIATREMTSPETVW
SGQQDAVTVRDAGWIQMFAENNQEILDMVIQGYKLAEHKDVLLPVNVCYDGFYLSHLTER
FEIPRQELADEFLESYSCNHVTLDPDKPMAVDPLTSSEILWRYRKSHLEAMQNALEVIDE
VDIEFDKVFGRKYGGAIDTYKIDDAELVIVTMGATTGTARVAVDKARDMGYKIGLLKVRF
LRPFPSQKIKEVLNSKKAYAVIDKSVSFGWNTGVLYNEIKSAVSDLGRAITSMPAIGGLG
GADISVDMLLDCIKKLDEESKNYNGQLATYWFE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataagaataagattgtagctataagtggtaataaatcagctgcaataggagcagca
ctttcaaaacctgatttgattgcagcatatcctattactcctcagtcttctgtagtagag
gctctagctgacatgatagcaaaaggcgagcttgattcaaatatggtacatgtggaatct
gaacattctgccatgagtgtagttcaaggagctactgttgctggaggaagaacgtttaca
gctacttcagctcaaggtctggcgcttatgtttgagccttattttagaatgtctacttta
agacttcccatggttatggcaatagcaactagagaaatgacatctccagaaactgtatgg
agtggacagcaggatgcagttactgtaagagatgctgggtggatacagatgtttgccgaa
aacaatcaagagattttagatatggtaatacaaggatataagcttgccgaacataaagat
gtattgcttccagtaaatgtctgttatgacggcttctatttatctcacttaacagaacga
ttcgagattcctagacaagaattagcagatgaatttctagaaagctatagctgtaaccat
gtaactcttgaccctgataagccaatggcagtagatcctctaacttcttctgaaattttg
tggagatatagaaagagccatttagaagctatgcaaaatgcattagaagtcatagacgaa
gtggatatagagtttgataaagtatttggaagaaaatatggaggagctatagacacctac
aagatagatgatgccgagcttgttatagttactatgggagctactactggtacagcaaga
gtggcagtagataaagcaagagatatgggctataagatagggttattaaaagtaagattt
ttaagaccatttcctagtcaaaaaatcaaagaagtgttaaatagtaaaaaagcatatgct
gtaattgacaaaagtgtaagttttggctggaacacaggagttttatacaatgaaattaaa
tcggcagtgtctgatttaggccgagctattactagtatgccagcaattggaggactagga
ggagcggatatttctgtagatatgttactggactgtattaagaagttggatgaggaaagt
aaaaattataatggacagttagccacctattggtttgagtga

DBGET integrated database retrieval system