KEGG   Clostridium sticklandii: CLOST_0755Help
Entry
CLOST_0755        CDS       T01334                                 

Gene name
porA
Definition
Pyruvate synthase subunit porA (Pyruvate oxidoreductase alpha chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit alpha) (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cst  Clostridium sticklandii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLOST_0755 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_0755 (porA)
   00020 Citrate cycle (TCA cycle)
    CLOST_0755 (porA)
   00620 Pyruvate metabolism
    CLOST_0755 (porA)
   00640 Propanoate metabolism
    CLOST_0755 (porA)
   00650 Butanoate metabolism
    CLOST_0755 (porA)
  Energy metabolism
   00680 Methane metabolism
    CLOST_0755 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CLOST_0755 (porA)
Enzymes [BR:cst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CLOST_0755 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888722..889903
Genome map
AA seq 393 aa AA seqDB search
MDKNKIVAISGNKSAAIGAALSKPDLIAAYPITPQSSVVEALADMIAKGELDSNMVHVES
EHSAMSVVQGATVAGGRTFTATSAQGLALMFEPYFRMSTLRLPMVMAIATREMTSPETVW
SGQQDAVTVRDAGWIQMFAENNQEILDMVIQGYKLAEHKDVLLPVNVCYDGFYLSHLTER
FEIPRQELADEFLESYSCNHVTLDPDKPMAVDPLTSSEILWRYRKSHLEAMQNALEVIDE
VDIEFDKVFGRKYGGAIDTYKIDDAELVIVTMGATTGTARVAVDKARDMGYKIGLLKVRF
LRPFPSQKIKEVLNSKKAYAVIDKSVSFGWNTGVLYNEIKSAVSDLGRAITSMPAIGGLG
GADISVDMLLDCIKKLDEESKNYNGQLATYWFE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataagaataagattgtagctataagtggtaataaatcagctgcaataggagcagca
ctttcaaaacctgatttgattgcagcatatcctattactcctcagtcttctgtagtagag
gctctagctgacatgatagcaaaaggcgagcttgattcaaatatggtacatgtggaatct
gaacattctgccatgagtgtagttcaaggagctactgttgctggaggaagaacgtttaca
gctacttcagctcaaggtctggcgcttatgtttgagccttattttagaatgtctacttta
agacttcccatggttatggcaatagcaactagagaaatgacatctccagaaactgtatgg
agtggacagcaggatgcagttactgtaagagatgctgggtggatacagatgtttgccgaa
aacaatcaagagattttagatatggtaatacaaggatataagcttgccgaacataaagat
gtattgcttccagtaaatgtctgttatgacggcttctatttatctcacttaacagaacga
ttcgagattcctagacaagaattagcagatgaatttctagaaagctatagctgtaaccat
gtaactcttgaccctgataagccaatggcagtagatcctctaacttcttctgaaattttg
tggagatatagaaagagccatttagaagctatgcaaaatgcattagaagtcatagacgaa
gtggatatagagtttgataaagtatttggaagaaaatatggaggagctatagacacctac
aagatagatgatgccgagcttgttatagttactatgggagctactactggtacagcaaga
gtggcagtagataaagcaagagatatgggctataagatagggttattaaaagtaagattt
ttaagaccatttcctagtcaaaaaatcaaagaagtgttaaatagtaaaaaagcatatgct
gtaattgacaaaagtgtaagttttggctggaacacaggagttttatacaatgaaattaaa
tcggcagtgtctgatttaggccgagctattactagtatgccagcaattggaggactagga
ggagcggatatttctgtagatatgttactggactgtattaagaagttggatgaggaaagt
aaaaattataatggacagttagccacctattggtttgagtga

DBGET integrated database retrieval system