KEGG   Clostridium sticklandii: CLOST_0755Help
Entry
CLOST_0755        CDS       T01334                                 

Gene name
porA
Definition
(GenBank) Pyruvate synthase subunit porA (Pyruvate oxidoreductase alpha chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit alpha) (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cst  Clostridium sticklandii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLOST_0755 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_0755 (porA)
   00020 Citrate cycle (TCA cycle)
    CLOST_0755 (porA)
   00620 Pyruvate metabolism
    CLOST_0755 (porA)
   00640 Propanoate metabolism
    CLOST_0755 (porA)
   00650 Butanoate metabolism
    CLOST_0755 (porA)
  Energy metabolism
   00680 Methane metabolism
    CLOST_0755 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CLOST_0755 (porA)
Enzymes [BR:cst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CLOST_0755 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
888722..889903
Genome map
AA seq 393 aa AA seqDB search
MDKNKIVAISGNKSAAIGAALSKPDLIAAYPITPQSSVVEALADMIAKGELDSNMVHVES
EHSAMSVVQGATVAGGRTFTATSAQGLALMFEPYFRMSTLRLPMVMAIATREMTSPETVW
SGQQDAVTVRDAGWIQMFAENNQEILDMVIQGYKLAEHKDVLLPVNVCYDGFYLSHLTER
FEIPRQELADEFLESYSCNHVTLDPDKPMAVDPLTSSEILWRYRKSHLEAMQNALEVIDE
VDIEFDKVFGRKYGGAIDTYKIDDAELVIVTMGATTGTARVAVDKARDMGYKIGLLKVRF
LRPFPSQKIKEVLNSKKAYAVIDKSVSFGWNTGVLYNEIKSAVSDLGRAITSMPAIGGLG
GADISVDMLLDCIKKLDEESKNYNGQLATYWFE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataagaataagattgtagctataagtggtaataaatcagctgcaataggagcagca
ctttcaaaacctgatttgattgcagcatatcctattactcctcagtcttctgtagtagag
gctctagctgacatgatagcaaaaggcgagcttgattcaaatatggtacatgtggaatct
gaacattctgccatgagtgtagttcaaggagctactgttgctggaggaagaacgtttaca
gctacttcagctcaaggtctggcgcttatgtttgagccttattttagaatgtctacttta
agacttcccatggttatggcaatagcaactagagaaatgacatctccagaaactgtatgg
agtggacagcaggatgcagttactgtaagagatgctgggtggatacagatgtttgccgaa
aacaatcaagagattttagatatggtaatacaaggatataagcttgccgaacataaagat
gtattgcttccagtaaatgtctgttatgacggcttctatttatctcacttaacagaacga
ttcgagattcctagacaagaattagcagatgaatttctagaaagctatagctgtaaccat
gtaactcttgaccctgataagccaatggcagtagatcctctaacttcttctgaaattttg
tggagatatagaaagagccatttagaagctatgcaaaatgcattagaagtcatagacgaa
gtggatatagagtttgataaagtatttggaagaaaatatggaggagctatagacacctac
aagatagatgatgccgagcttgttatagttactatgggagctactactggtacagcaaga
gtggcagtagataaagcaagagatatgggctataagatagggttattaaaagtaagattt
ttaagaccatttcctagtcaaaaaatcaaagaagtgttaaatagtaaaaaagcatatgct
gtaattgacaaaagtgtaagttttggctggaacacaggagttttatacaatgaaattaaa
tcggcagtgtctgatttaggccgagctattactagtatgccagcaattggaggactagga
ggagcggatatttctgtagatatgttactggactgtattaagaagttggatgaggaaagt
aaaaattataatggacagttagccacctattggtttgagtga

DBGET integrated database retrieval system