KEGG   Acetoanaerobium sticklandii: CLOST_0756Help
Entry
CLOST_0756        CDS       T01334                                 

Definition
(GenBank) NADH dependant phenylglyoxylate (fragment)
Organism
cst  Acetoanaerobium sticklandii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
889926..890825
Genome map
AA seq 299 aa AA seqDB search
MNYIDLLRESEDLVTPGMSACQGCAAEMCLRRVLQVAGRNTIMTIPPGCMAGAGVVGWNF
DNGLKVPVHIPLLDNTASFLSGVSNMYQRKNRQDVNIIAFAGDGATADCGFQSLSGAAER
AEKFLYICYDNEGYMNTGFQRSSTSSKGSKTSTTPVGSAGGGKSQNQKYMPLILAMHNAE
YVATASPSNMKDLVEKVTKGIEASKRGFAYIHIFSPCPTGWGHDTNLSIDIAKKAVKSNF
FPLFEVDRGNWKLLDNKNPIPVSEWMVKLKKFSHLSDDDIIAIQDLADKRMELLRKLSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatagatttgctaagagaatcagaagatctagtaacacctggcatgtcggct
tgccaaggatgtgcagcagagatgtgcctaagaagagtgcttcaagtagctggaagaaat
actattatgactataccacctggatgtatggctggagctggagtagtaggctggaatttt
gacaatggtctcaaggttcctgttcatataccacttcttgacaatacagcatcattttta
agtggagtaagcaatatgtatcagcgcaaaaatagacaggatgtaaatataattgctttt
gcaggtgatggagcaactgcggattgcggttttcaatctttatctggagcggctgaaaga
gctgagaagttcttatatatatgctatgacaatgaaggatatatgaatacgggatttcaa
agaagctcgacttcatcaaagggatcaaaaacctctactacaccagtaggctcagcagga
gggggtaagtctcaaaatcaaaagtatatgccactaattttggctatgcataatgcggag
tatgtggctactgcttcaccttctaatatgaaggatttagttgaaaaagttactaaagga
atagaggcaagtaaaagaggctttgcatatattcatattttttcaccttgtcctactggg
tggggacacgatacaaatctaagtattgatatagctaaaaaagcagttaaatcaaatttc
tttccactttttgaagtagatagaggaaactggaagcttttagataataaaaatcctatt
cctgtttctgagtggatggtaaagctcaaaaaatttagtcatttatctgatgatgacata
atagctattcaagatttagcagacaaaaggatggaacttttaagaaagttaagtagctag

DBGET integrated database retrieval system