KEGG   Acetoanaerobium sticklandii: CLOST_0756Help
Entry
CLOST_0756        CDS       T01334                                 

Definition
(GenBank) NADH dependant phenylglyoxylate (fragment)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
cst  Acetoanaerobium sticklandii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLOST_0756
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_0756
   00020 Citrate cycle (TCA cycle)
    CLOST_0756
   00620 Pyruvate metabolism
    CLOST_0756
   00640 Propanoate metabolism
    CLOST_0756
   00650 Butanoate metabolism
    CLOST_0756
  Energy metabolism
   00680 Methane metabolism
    CLOST_0756
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CLOST_0756
Enzymes [BR:cst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CLOST_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
889926..890825
Genome map
AA seq 299 aa AA seqDB search
MNYIDLLRESEDLVTPGMSACQGCAAEMCLRRVLQVAGRNTIMTIPPGCMAGAGVVGWNF
DNGLKVPVHIPLLDNTASFLSGVSNMYQRKNRQDVNIIAFAGDGATADCGFQSLSGAAER
AEKFLYICYDNEGYMNTGFQRSSTSSKGSKTSTTPVGSAGGGKSQNQKYMPLILAMHNAE
YVATASPSNMKDLVEKVTKGIEASKRGFAYIHIFSPCPTGWGHDTNLSIDIAKKAVKSNF
FPLFEVDRGNWKLLDNKNPIPVSEWMVKLKKFSHLSDDDIIAIQDLADKRMELLRKLSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatagatttgctaagagaatcagaagatctagtaacacctggcatgtcggct
tgccaaggatgtgcagcagagatgtgcctaagaagagtgcttcaagtagctggaagaaat
actattatgactataccacctggatgtatggctggagctggagtagtaggctggaatttt
gacaatggtctcaaggttcctgttcatataccacttcttgacaatacagcatcattttta
agtggagtaagcaatatgtatcagcgcaaaaatagacaggatgtaaatataattgctttt
gcaggtgatggagcaactgcggattgcggttttcaatctttatctggagcggctgaaaga
gctgagaagttcttatatatatgctatgacaatgaaggatatatgaatacgggatttcaa
agaagctcgacttcatcaaagggatcaaaaacctctactacaccagtaggctcagcagga
gggggtaagtctcaaaatcaaaagtatatgccactaattttggctatgcataatgcggag
tatgtggctactgcttcaccttctaatatgaaggatttagttgaaaaagttactaaagga
atagaggcaagtaaaagaggctttgcatatattcatattttttcaccttgtcctactggg
tggggacacgatacaaatctaagtattgatatagctaaaaaagcagttaaatcaaatttc
tttccactttttgaagtagatagaggaaactggaagcttttagataataaaaatcctatt
cctgtttctgagtggatggtaaagctcaaaaaatttagtcatttatctgatgatgacata
atagctattcaagatttagcagacaaaaggatggaacttttaagaaagttaagtagctag

DBGET integrated database retrieval system