KEGG   Clostridium sticklandii: CLOST_0931Help
Entry
CLOST_0931        CDS       T01334                                 

Gene name
ispE
Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cst  Clostridium sticklandii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLOST_0931 (ispE)
Enzymes [BR:cst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CLOST_0931 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1069108..1070037
Genome map
AA seq 309 aa AA seqDB search
MFLLYKKYIIINCPFGGSMEKLVVKANAKINLTLDVIDKREDGYHLLDMVMHSVGIYDEI
TIKKNYENNIKVSCDNNSLEIDEMNSAFKAAKLIMEEKEFSGVDIHINKTIPIGAGMAGG
SADAAAVIVGINELFNLNMSLEEMKSIALKIGADVPFCIEGGCVRATGIGEKMEKLPIMD
LNLLIIKPDESISTAFVYKNLILSELANRPDNNGFIKAMNNNLDEMVKTMGNVLESVTAS
KVSFINEIKKDMINGKAKISMMTGSGTAVFGIFESISDLKDCYESLRFKYNEIFVTKTER
GGVYIESRD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgttcttattgtataaaaaatacattattatcaattgtccttttggaggaagtatggaa
aagttagtagtaaaagcaaatgcaaagataaaccttactttggatgttatagataaacgc
gaagatggctaccatttgttggatatggtaatgcacagcgtgggtatatatgatgaaata
actataaaaaagaattatgaaaacaatataaaggtaagctgtgataataatagcttagaa
atagacgaaatgaactctgcatttaaggcagcaaagttaattatggaagaaaaagaattt
tcaggagtggacatacatattaataaaaccataccaattggcgcaggaatggctggggga
agtgcagatgcagccgctgtaatagttggaataaatgagctttttaatctcaacatgtca
cttgaggaaatgaaaagtatagctcttaaaataggagcagatgtacccttttgtatagaa
ggagggtgtgtaagagcaacaggaattggagaaaaaatggaaaagctcccaattatggat
ttgaatctgctaattattaagccagatgagtctatatctacagcttttgtatataagaat
ctaattctttcagaacttgcaaatagacctgacaataatggctttataaaggctatgaat
aataatttagatgagatggtaaaaactatgggtaatgtattagaaagtgttacagcaagt
aaagtttcatttataaacgaaataaaaaaagatatgataaatggcaaggcgaaaatttct
atgatgactggcagtggaactgcagtatttggaattttcgaatccatttcagatttgaaa
gattgctatgagagtttaagatttaaatataatgaaatttttgtaactaaaacagagaga
ggaggagtttatattgaatcgagggattaa

DBGET integrated database retrieval system