KEGG   Clostridium sticklandii: CLOST_0978Help
Entry
CLOST_0978        CDS       T01334                                 

Gene name
btuE
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cst  Clostridium sticklandii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CLOST_0978 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CLOST_0978 (btuE)
Enzymes [BR:cst01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CLOST_0978 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1122960..1123505)
Genome map
AA seq 181 aa AA seqDB search
MNIYDFTAKDIDGNLVSLQDYKGKVLIVVNTASKCGFTPQYEDLQKLYDNYKDKGVEILG
FPCNQFMDQEPGTNQETKSFCSLNYGVNFPLFEKTDVNGKFAHPLFKYLVSEAPFKGFDM
SNPTNKMLDAMLKDKFPEFAVGDAVKWNFTKFIIDKEGNVVNRFEPATEPMDMVSTIENL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttatgattttactgctaaggatatcgatggtaatttagtttctcttcaagat
tataaaggtaaggtacttatagttgtaaacacggctagcaaatgtggctttactccccaa
tacgaggatttgcaaaagctatatgataattacaaggacaaaggggtagagattttaggt
ttcccatgtaatcaatttatggatcaagaacctggaacaaaccaagaaacaaaatctttt
tgttctcttaactacggtgttaactttccactattcgaaaaaacagatgtaaatgggaaa
tttgctcatccattatttaaatatttagtgtctgaagctccatttaaaggttttgatatg
tcaaatcctacaaacaaaatgctagatgctatgctaaaagataagttccctgaatttgct
gtaggcgatgctgtaaaatggaactttacaaagtttatcatcgataaagaaggtaatgta
gttaatagatttgaacctgctacagagcctatggatatggtttccactatagaaaattta
ttataa

DBGET integrated database retrieval system