KEGG   Clostridium sticklandii: CLOST_1000Help
Entry
CLOST_1000        CDS       T01334                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cst  Clostridium sticklandii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cst00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1142058..1143017
Genome map
AA seq 319 aa AA seqDB search
MIKRPRRLRSTANVRALVRETHLNKSGLVYPIFVVEGEGIKREISSLKDCYHYSVDMLDD
EIKELKSLGINSVMLFGIPELKDEEATSAYDENGIVQKAIRRIKSYAPDFYVITDVCMCQ
YTTHGHCGIISEAGEVLNDVTIDYIAKIALSHVKAGADMVAPSDMMDGRIGAIRSLLDES
GFYNTPIMAYSAKYASAYYGPFRVAASSAPGFGDRKTYQMDFHNTDEALREVELDIEEGA
DIVMVKPAMSYMDVISRVKSSYNIPVAAYNVSGEYAMLKMAVEQGIMNESVIYETMVSIK
RAGADIIITYFAKDIAKML
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaagacctagaagacttcgtagtacagcaaatgtaagagctttagtaagagaa
actcatcttaataagtctggacttgtatatcctatatttgtagtagaaggagagggaata
aaacgtgaaatctcctctcttaaggattgctatcattactctgtggatatgcttgatgac
gaaataaaagagctaaagagccttggtataaattcagttatgctctttggtatacctgaa
ttaaaagatgaagaagctactagtgcctatgatgaaaacgggatagttcaaaaggcaata
agaagaataaagagctatgctccagatttttatgtaataacggatgtatgtatgtgtcaa
tataccacgcatggacattgtggaattatttctgaagctggagaagtgctaaatgatgta
acaatagactatattgctaagattgctctaagccatgttaaagctggagcagatatggtt
gctccttctgatatgatggatggaagaataggggcaattagaagcctactggatgagagc
ggcttttataacactccgataatggcatatagtgcaaaatacgcttctgcatactatgga
ccatttagagtagcagcttcatctgcacctggatttggagacaggaaaacatatcagatg
gactttcataacactgatgaagccttaagagaagttgagctggatatagaagaaggtgca
gacatagtaatggtaaagcctgctatgtcttatatggatgtgattagtagagtaaagagc
tcatacaacataccagtagctgcatacaatgtaagcggagaatacgctatgttaaagatg
gcagtagagcaaggtattatgaatgaatctgtgatttatgaaacaatggttagtataaaa
agagcgggagcagatataataataacttattttgctaaagatattgcaaaaatgctataa

DBGET integrated database retrieval system