KEGG   Clostridium sticklandii: CLOST_1027Help
Entry
CLOST_1027        CDS       T01334                                 

Gene name
GLC
Definition
1,4-alpha-glucan-branching enzyme (Glycogen-branching enzyme) (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cst  Clostridium sticklandii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLOST_1027 (GLC)
Enzymes [BR:cst01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CLOST_1027 (GLC)
Exosome [BR:cst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLOST_1027 (GLC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1168693..1170714)
Genome map
AA seq 673 aa AA seqDB search
MKTKEKVRSKIKLVEFDPWLEPYEDHIKTRISKYKKDRKKLLSDADDFTDFANGHLYFGF
HRSNKGWYYREWAPGADSLHLIGEFNNWNPSSHPLTHLGNGYWEIFLDGKKSLWHECLVK
VRVTKDNISHDKIPLYIKRVIQDPNTLNFTGQIYCPDNDYKWMNPSFKIPKKQDLLIYEA
HVGMAQEKEAIGSFSEFTNIVLPKIKEKGYNAVQLMAVMQHPYYASFGYHVSNFFAVSSW
FGTPDELKVLIDTAHSMDIAVFMDIVHSHVVKNTDDGINEFDGTSYQFFHEGARGNHPAW
DSKLFDYSKPEVIHFLLSNIKYWMDEYHFDGFRFDGITSMLYLDHGLGKSFTNYDQYFSD
NTDLDAVTYLQFANALIKKIKPTAITIAEDMSGMPGMCLPISYGGLGFDYRLAMGLPDFW
IRMLEQRDETWNMYTLWYEAVSKRPHEKRIGYCESHDQAMVGDKTIMFRLCDEVMYWHMH
KSDNHYVIDRAIALHKLIRFFTLTAASEAYLNFMGNEFGHPDWIDFPRQGNDWSYKYAQR
RWSLEENLELKYEYLSTFDRFMVYFAQNHDILKKSEFIQDLFIDDTRKLIVFKKQDLIFI
FNFHPTDSYSDLCFPTKDSNSYKAVFDSDLDIFGGYNRVSRDIVYHSINNLKFNENCITI
YSPSRTCIVLEKL
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaggaaaaggtgaggtctaaaatcaagttagtagaatttgacccgtggcta
gaaccttatgaagaccatataaaaactaggatttctaaatacaaaaaagatagaaagaag
ttactatcggatgctgatgattttactgattttgcaaatggtcatctttattttggattt
cataggtcaaataaaggatggtactatagagaatgggctcctggagccgattctctacat
cttataggtgagtttaacaactggaatccaagctctcatcctcttacccatttaggtaat
ggttactgggagatttttttagatggaaaaaagtctctttggcatgagtgtttagtaaag
gtaagagttaccaaagataatataagtcatgataagattccactatatattaaacgtgta
attcaagatccaaatacacttaattttactggtcaaatctactgtcctgataatgactac
aaatggatgaatccttcttttaaaattcctaaaaagcaagatttacttatttatgaggct
catgtaggaatggctcaggaaaaagaagctatagggagtttttctgagtttacaaatatt
gttttacctaagataaaggaaaaaggctataatgcagttcagcttatggctgtcatgcag
catccatactatgcatcctttggctatcatgtttctaatttttttgctgtttcgtcgtgg
tttggaactccagatgagcttaaggttttaatcgatacggctcatagtatggatatagct
gtgtttatggatatagtccattctcacgttgtaaaaaacactgatgacggaataaatgag
tttgatggaactagttatcaattttttcatgaaggagctagaggaaaccatcctgcttgg
gattcgaagctttttgattactcaaagcctgaagtgattcactttttgctttcaaatatc
aagtactggatggatgaatatcattttgatggatttagatttgatggtattacttccatg
ctttatctagaccatggattgggtaagagtttcactaattatgaccagtatttctctgat
aatactgatttggatgctgtaacttatcttcagtttgcaaatgctcttattaaaaagatt
aaacccactgcaataactatagctgaagatatgagtggtatgcctggaatgtgtcttcct
atttcttacggtggattgggatttgattataggcttgctatgggacttcctgatttttgg
ataaggatgcttgagcaaagagatgaaacttggaatatgtatactctctggtatgaagcc
gtttcaaaaaggccacatgaaaaacgtataggttactgcgaatctcatgaccaagctatg
gttggagacaaaactattatgtttaggttatgtgatgaggttatgtattggcatatgcat
aaatctgataaccactatgtaatagatagggctatagctcttcataagctgattagattt
tttaccttgacggctgccagtgaagcttatctgaattttatgggcaatgaatttggacat
ccagactggatagattttccaaggcaaggaaatgattggagttacaagtatgctcagagg
agatggagccttgaagagaatttagaattaaagtatgaatatttgagtacttttgataga
ttcatggtgtattttgctcaaaatcatgatattctaaagaaaagcgagtttattcaggac
ttatttatcgatgatactaggaagctaatcgtatttaaaaaacaggatttaatttttatt
tttaacttccatcctacagattcatattctgatttatgcttccctactaaagattctaat
tcatacaaggctgttttcgattctgatttggatatctttggaggctataacagagtaagc
cgagacatagtgtatcatagtataaataatcttaagttcaatgaaaactgtattacaatt
tatagccctagccgaacttgcatagtcctagaaaagctttaa

DBGET integrated database retrieval system