KEGG   Clostridium sticklandii: CLOST_1215Help
Entry
CLOST_1215        CDS       T01334                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (Amylomaltase) (Disproportionating enzyme) (D-enzyme) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cst  Clostridium sticklandii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cst00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1366573..1368069
Genome map
AA seq 498 aa AA seqDB search
MINKIQEPFERGAGTLLPVASLPSNYGIGTFGKAAYDFVDFLHKSGQKYWQVLPIGPTGY
GDSPYQSFSAFAGNPYFIDFDFLIEENLLDIRDIEKINWGDNPNLIDYGKIYENRYSVLR
VAFKNFNTSDESFIEFCDANSFWLDDYSDYMAIKDLFKGVEWLKWPEDIRNRDKDALENY
RIKLSDDIMFWKFLQFKFIVQLNQLKKYAHNKNITIIGDIPIYVALDSSDVWANLKEFQM
DESKKPTMVAGVPPDMFSSTGQLWGNPLYDWDYMKADNFSWWRKRMKYSALLYDIIRIDH
FIGIVHYYSIKYGEETAMNGFWKDGPGHDLINSINEEIGSSKIIAEDLGVVTQKVKQLLK
DSGYPGMRLLQFGFDSDARNENLAKHCPSNSVVYGGTHDNETLRGYFQNLDSKSRAKARK
MLDIKQNRFFVWKVIESGFKSKANTVIFQIQDYLELDNSARMNVPSTIGGNWCWRLLPNQ
ISDDLIHKIENLIKITKR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaatacaagaaccttttgaaagaggcgcaggtactttgcttccagttgca
agtctgccgtctaactatggaataggaacatttggtaaggccgcatatgactttgttgac
tttctacataaatctggccaaaaatattggcaggtacttcctattggacctacaggttat
ggtgatagtccatatcaaagtttctctgcatttgctggaaatccatattttatagatttt
gatttcttgattgaagaaaatcttttagatattagggatatcgaaaaaataaattgggga
gataacccaaacctaatcgattatggaaagatatatgagaatagatacagtgttttaaga
gttgcctttaaaaatttcaatacatctgatgaatcctttattgaattttgtgatgctaat
agcttttggttagatgattatagtgactatatggctataaaagatttattcaaaggtgta
gaatggcttaaatggccagaggatataagaaacagagataaggatgctttggaaaactat
agaataaaattatcagatgatataatgttttggaaattcctacaattcaagttcattgtt
cagctaaatcaattaaagaaatatgcacataataaaaatataactataatcggcgatata
ccaatttatgttgctcttgacagttccgatgtttgggcaaatttaaaagagtttcaaatg
gatgagagcaaaaaaccaactatggtagctggagttccaccagatatgttttcatcaact
ggccagctttggggaaatccactttatgattgggattatatgaaagccgataactttagc
tggtggcgtaaaagaatgaaatattcagctcttttatacgacatcataaggatagaccac
ttcattggaatagttcattattattctataaaatatggtgaagaaactgctatgaatggt
ttttggaaagatggcccaggtcatgatttaattaattctattaatgaagaaattggaagt
tcaaaaatcattgctgaagacctaggggttgttacccagaaggttaagcagcttttaaaa
gatagtggttatccaggtatgaggctcttacaatttggatttgattcagatgctagaaac
gagaatctagctaagcattgtccttcgaactctgttgtttacggtggcactcacgataat
gaaactcttagaggatattttcaaaacctagattctaaatccagagctaaagctagaaaa
atgcttgatattaagcagaatagattttttgtgtggaaagttattgaatctgggtttaaa
tcaaaagcaaatactgtgatattccaaatacaagactatctagagcttgataattctgcc
agaatgaatgttccatcaaccattggtggaaactggtgctggagattattaccaaatcaa
atcagtgatgatttaatacacaaaatagaaaatttaattaagataacaaaaagatag

DBGET integrated database retrieval system