KEGG   Clostridium sticklandii: CLOST_1234Help
Entry
CLOST_1234        CDS       T01334                                 

Definition
(RefSeq) Glutamine synthetase, catalytic region
  KO
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
cst  Clostridium sticklandii
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLOST_1234
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CLOST_1234
  Energy metabolism
   00910 Nitrogen metabolism
    CLOST_1234
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLOST_1234
   00220 Arginine biosynthesis
    CLOST_1234
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CLOST_1234
Enzymes [BR:cst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     CLOST_1234
Exosome [BR:cst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLOST_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1389929..1391845
Genome map
AA seq 638 aa AA seqDB search
MPSEIKFLPLDNLLYVIKKENHDFEYLKTLLSNHPEIKFVSLVGMDLKGNGTDERIPIQS
MLDDMESFFSLGIQTDGSSVVLHNIATLNDAKVIILPDLKVNWHVDYNFGHLDHITGLPI
GTLRIPAFLIHNNKMVCSRSILKKAVKRFKNNCLEIIENSESLKDELGIKDKKIKTIHMT
SATELEFWVQTPEDKADEEKLSTSQTLKEQYWKRTEGTVRTAMEKTILMMEKYGFEPEMG
HKEVGGVRPQINVSGKQSHIMEQLEIDWKYTNTLQCADNEHFIRHLVLDVFNSHGLEVTF
AAKPIEGVAGSGEHTHLGIMAELEDGTKVNLFAHKNFKEEYMSSIGFSSLMGILKNYEVI
NPFVTSTNDALNRLKPGFEAPVCIVSSLGHSPEFPSRNRSILVGLIKDIETPLSTRFELR
APNPNSNTYLVLASCYQCMLDGISKLAGKYSLKQLEAEFSKKVGDESIYLEKNREYRSEF
DVFEHYTESERSELFGKPPATVYENVIAFDSYPEKVETLIEGEVFTKAIIDSYKTSTIDM
WINELRGRIIEDNMNLVRNCAKVHDDEISDLDIVNWNRINTLRWELMKDSVDKKSIFTNI
RSQILLNDLNEVSNLQKIMSDKVKLLKELYLAYKKNIF
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtgaaataaaatttttacctttggacaatttgctttatgtaataaaaaaagaa
aaccatgattttgagtatttaaaaactttacttagcaaccaccctgaaattaagttcgtt
tcattagtaggtatggatctaaaaggcaacggtactgacgaaagaatccctatacaatcc
atgcttgatgacatggaaagtttcttcagcctaggaattcaaactgacggttcaagtgtt
gttttacataatatagctactttaaatgatgctaaagttataattctaccagatttaaag
gtaaattggcatgttgattataatttcggacatttagaccatataactggtttacctatc
ggaacgcttagaataccagcttttttaattcataataacaaaatggtttgttctagatct
atactaaaaaaagcagttaaaagatttaaaaataattgtcttgaaatcatagaaaatagc
gaatctttaaaagacgagcttggcattaaagataaaaaaataaaaactatacacatgact
tcagcaactgaactagagttttgggttcaaacaccagaagacaaagcagacgaagaaaaa
ctatcaacttctcaaacgcttaaggagcaatactggaaacgtacagaaggaaccgtaaga
actgcaatggaaaaaaccatattgatgatggaaaaatatggtttcgagccagaaatgggt
cataaagaagtaggaggagtaagacctcaaatcaatgtaagcggaaagcaaagccatatt
atggagcagcttgaaatagattggaaatatacaaacactcttcaatgcgcagacaatgag
cactttataagacatttagttctggacgtatttaacagccatggcttagaagtaacattt
gccgccaaaccaatagaaggtgtagctggtagtggagagcatactcatctaggaattatg
gcagagcttgaagatggtactaaagtaaacttatttgctcataaaaatttcaaagaagaa
tatatgagttcgataggcttttcatcattaatgggaatactaaagaattacgaagttatt
aatcctttcgttacatcaacaaatgacgcattaaatagattaaagccaggcttcgaagct
cctgtttgcattgtatcttctctaggacattcgccagagtttccatctagaaatagatct
atcctagttggattaataaaagatatagaaacacctttatcaacaagatttgagcttaga
gctccaaatcctaactctaatacttatctagtattagcttcctgctatcaatgtatgctt
gatggtatatccaaacttgctggaaaatatagcttgaagcaattagaagcggaattttca
aaaaaagttggagatgaatcaatttacttagaaaaaaatagagagtacagaagcgagttt
gacgtatttgagcattacacagaatctgaaagatctgagctttttggaaagcctcctgct
actgtatatgaaaatgtgattgcttttgatagttatcctgaaaaagttgaaactttaata
gagggcgaggtttttacaaaagctattattgattcatacaaaacctcaacaatcgatatg
tggattaacgagcttagaggaagaataatagaagacaatatgaatttagtgagaaattgt
gctaaggttcatgatgacgaaatttcggatttagatattgttaactggaatagaattaat
actttgagatgggagctaatgaaggatagtgtagataaaaaatctatctttactaatatt
agaagtcaaatccttctcaatgacctaaacgaagtttcaaacttgcaaaaaattatgagc
gataaagttaaattacttaaagagctttatttagcatataaaaagaacatcttctag

DBGET integrated database retrieval system