KEGG   Clostridium sticklandii: CLOST_1234Help
Entry
CLOST_1234        CDS       T01334                                 

Definition
Glutamine synthetase, catalytic region
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
cst  Clostridium sticklandii
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLOST_1234
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CLOST_1234
  Energy metabolism
   00910 Nitrogen metabolism
    CLOST_1234
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLOST_1234
   00330 Arginine and proline metabolism
    CLOST_1234
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CLOST_1234
Enzymes [BR:cst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     CLOST_1234
Exosome [BR:cst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLOST_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1389929..1391845
Genome map
AA seq 638 aa AA seqDB search
MPSEIKFLPLDNLLYVIKKENHDFEYLKTLLSNHPEIKFVSLVGMDLKGNGTDERIPIQS
MLDDMESFFSLGIQTDGSSVVLHNIATLNDAKVIILPDLKVNWHVDYNFGHLDHITGLPI
GTLRIPAFLIHNNKMVCSRSILKKAVKRFKNNCLEIIENSESLKDELGIKDKKIKTIHMT
SATELEFWVQTPEDKADEEKLSTSQTLKEQYWKRTEGTVRTAMEKTILMMEKYGFEPEMG
HKEVGGVRPQINVSGKQSHIMEQLEIDWKYTNTLQCADNEHFIRHLVLDVFNSHGLEVTF
AAKPIEGVAGSGEHTHLGIMAELEDGTKVNLFAHKNFKEEYMSSIGFSSLMGILKNYEVI
NPFVTSTNDALNRLKPGFEAPVCIVSSLGHSPEFPSRNRSILVGLIKDIETPLSTRFELR
APNPNSNTYLVLASCYQCMLDGISKLAGKYSLKQLEAEFSKKVGDESIYLEKNREYRSEF
DVFEHYTESERSELFGKPPATVYENVIAFDSYPEKVETLIEGEVFTKAIIDSYKTSTIDM
WINELRGRIIEDNMNLVRNCAKVHDDEISDLDIVNWNRINTLRWELMKDSVDKKSIFTNI
RSQILLNDLNEVSNLQKIMSDKVKLLKELYLAYKKNIF
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtgaaataaaatttttacctttggacaatttgctttatgtaataaaaaaagaa
aaccatgattttgagtatttaaaaactttacttagcaaccaccctgaaattaagttcgtt
tcattagtaggtatggatctaaaaggcaacggtactgacgaaagaatccctatacaatcc
atgcttgatgacatggaaagtttcttcagcctaggaattcaaactgacggttcaagtgtt
gttttacataatatagctactttaaatgatgctaaagttataattctaccagatttaaag
gtaaattggcatgttgattataatttcggacatttagaccatataactggtttacctatc
ggaacgcttagaataccagcttttttaattcataataacaaaatggtttgttctagatct
atactaaaaaaagcagttaaaagatttaaaaataattgtcttgaaatcatagaaaatagc
gaatctttaaaagacgagcttggcattaaagataaaaaaataaaaactatacacatgact
tcagcaactgaactagagttttgggttcaaacaccagaagacaaagcagacgaagaaaaa
ctatcaacttctcaaacgcttaaggagcaatactggaaacgtacagaaggaaccgtaaga
actgcaatggaaaaaaccatattgatgatggaaaaatatggtttcgagccagaaatgggt
cataaagaagtaggaggagtaagacctcaaatcaatgtaagcggaaagcaaagccatatt
atggagcagcttgaaatagattggaaatatacaaacactcttcaatgcgcagacaatgag
cactttataagacatttagttctggacgtatttaacagccatggcttagaagtaacattt
gccgccaaaccaatagaaggtgtagctggtagtggagagcatactcatctaggaattatg
gcagagcttgaagatggtactaaagtaaacttatttgctcataaaaatttcaaagaagaa
tatatgagttcgataggcttttcatcattaatgggaatactaaagaattacgaagttatt
aatcctttcgttacatcaacaaatgacgcattaaatagattaaagccaggcttcgaagct
cctgtttgcattgtatcttctctaggacattcgccagagtttccatctagaaatagatct
atcctagttggattaataaaagatatagaaacacctttatcaacaagatttgagcttaga
gctccaaatcctaactctaatacttatctagtattagcttcctgctatcaatgtatgctt
gatggtatatccaaacttgctggaaaatatagcttgaagcaattagaagcggaattttca
aaaaaagttggagatgaatcaatttacttagaaaaaaatagagagtacagaagcgagttt
gacgtatttgagcattacacagaatctgaaagatctgagctttttggaaagcctcctgct
actgtatatgaaaatgtgattgcttttgatagttatcctgaaaaagttgaaactttaata
gagggcgaggtttttacaaaagctattattgattcatacaaaacctcaacaatcgatatg
tggattaacgagcttagaggaagaataatagaagacaatatgaatttagtgagaaattgt
gctaaggttcatgatgacgaaatttcggatttagatattgttaactggaatagaattaat
actttgagatgggagctaatgaaggatagtgtagataaaaaatctatctttactaatatt
agaagtcaaatccttctcaatgacctaaacgaagtttcaaacttgcaaaaaattatgagc
gataaagttaaattacttaaagagctttatttagcatataaaaagaacatcttctag

DBGET integrated database retrieval system