KEGG   Clostridium sticklandii: CLOST_1648Help
Entry
CLOST_1648        CDS       T01334                                 

Gene name
pfkA
Definition
6-phosphofructokinase I (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cst  Clostridium sticklandii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLOST_1648 (pfkA)
   01230 Biosynthesis of amino acids
    CLOST_1648 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLOST_1648 (pfkA)
   00030 Pentose phosphate pathway
    CLOST_1648 (pfkA)
   00051 Fructose and mannose metabolism
    CLOST_1648 (pfkA)
   00052 Galactose metabolism
    CLOST_1648 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CLOST_1648 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CLOST_1648 (pfkA)
Enzymes [BR:cst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLOST_1648 (pfkA)
Protein phosphatases and associated proteins [BR:cst01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLOST_1648 (pfkA)
Messenger RNA biogenesis [BR:cst03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLOST_1648 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1780960..1781919)
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRYSIYHDIKVYGVQRGYKGLMEGELQEMSISSVGDI
IHRGGTILRSARSLEFKEKEGQKKALNVLDVFKIDGLVVIGGDGSFMGAKALSEQGFPAI
GIPGTIDNDLAYTDFTIGFDTAVNTALDAISKLRDTTSSHERVSIIEVMGRNCGDIALYA
GLAGGAEAILVPEMPYDLDEICKKLISSNNRGKTQSIILVAEGVGSATEIGHVIQERTGL
EARSTILGHIQRGGTPSATDRLLGSRLGGAAVQLLIDGKSSRVVGIKDNDIIDLDIHEAL
SMKRQFNLDMYNLAQILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagtattaacaagtgggggagatgctcctggaatgaatgctgctatc
agagcggtagtaagatactcaatttatcatgatattaaggtatacggagttcaaagaggc
tataaaggtctcatggaaggcgagctacaagaaatgtcaatttcatctgtaggcgatatt
atccatagaggaggtactatacttcgctcagctagatctttagaatttaaagaaaaagaa
ggtcaaaaaaaggctttaaatgttttagatgtatttaaaatagacggcttagtagtaatc
ggtggagatggttcatttatgggagctaaagcactcagtgaacagggctttcctgcaata
ggtattccaggaacgattgacaatgacttggcatatacagattttactataggctttgat
acagctgtaaacactgctctagatgcaatcagtaagcttagagatactacctcctcgcat
gaaagagtgagcataattgaagtgatgggcagaaactgtggggacatagcattatacgca
ggactagcaggtggagctgaggcaattttagttccagaaatgccttatgatttggatgaa
atatgcaaaaagcttataagctcaaataatagaggaaaaactcaaagtataattttagtt
gcagagggtgtaggctcagctacagaaataggccacgtgatacaagaaagaactggacta
gaggcgagatctaccatacttggacatatacaaagaggtggaacaccatcagctacagac
agactacttggaagcaggctaggaggagcggcagttcagcttctaatagatggaaaatct
tctagagttgtaggaattaaagacaatgacattatagatttggatatacatgaagcgctt
agcatgaaaagacaatttaatttagatatgtacaatctagctcagatactttctatatag

DBGET integrated database retrieval system