KEGG   Clostridium sticklandii: CLOST_1761Help
Entry
CLOST_1761        CDS       T01334                                 

Gene name
mtrA
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cst  Clostridium sticklandii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cst00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1888331..1888924)
Genome map
AA seq 197 aa AA seqDB search
MSNEIKAVEKMDKDKIKRAVRDILEAIGEDPDREGLVDTPKRIANMFEEIFAGLHQDPRE
HLQIFFQEENHEEMVIVKDISFYSVCEHHLVPFFGKAHVAYIPKGGKLTGLSKLARVVET
AARRPQLQERIAKTVADSIVEVLDPYGVVVILEAEHMCMTMRGIKKPGSKTITSAVRGIF
EKDVAARAEAMSLINIK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgaaattaaagctgttgaaaaaatggataaggataagataaaaagagcagtg
agagatattttagaggctattggagaagacccagatagagagggactagttgatactcca
aagagaattgcaaatatgtttgaagaaatatttgcaggtcttcatcaagatcctagagag
catcttcaaatatttttccaagaagaaaatcatgaagaaatggttatagttaaggatata
tctttttactcagtatgcgagcatcacctagtaccgttttttggaaaagctcacgtggca
tatatacctaaaggtggaaagctaacagggttatccaaacttgctagagtagttgagact
gctgcaagaagacctcagcttcaagaaagaattgcaaaaacggtagcagattcaatagta
gaggttcttgatccatatggagtagtagttattctagaagctgagcatatgtgtatgact
atgagaggaattaaaaagcctggctcaaaaacaataacatcagcagttagaggaatattt
gaaaaagatgtagcagcaagagcagaggctatgtcgcttataaatataaaatag

DBGET integrated database retrieval system