KEGG   Acetoanaerobium sticklandii: CLOST_1860Help
Entry
CLOST_1860        CDS       T01334                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00230  Purine metabolism
cst01100  Metabolic pathways
Module
cst_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLOST_1860 (gmk)
Enzymes [BR:cst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLOST_1860 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 AAA_16 ABC_tran ADK AAA_17 Thymidylate_kin RNA_helicase DUF948 Cytidylate_kin RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: CBH21980
UniProt: E3PSX6
Position
complement(1985068..1985682)
Genome map
AA seq 204 aa AA seqDB search
MKKKGLLVVVSGPSGAGKGTICKNFMELNKQMLLSISSTTRNPRENEIDGVNYNFITKQD
FEDLIGTDSLLEYVHVFGNYYGTPKKWVLECIEKGKDVLLEIEIVGAMKVKEKYPDAILV
FVLPPSLKELKNRIVTRGTETIEQIENRMARAMQEIKTIEKYDYFIFNDNLTRAVDDLEA
IISAEKNKVNRYSQEIVKIYEEEL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaggtttattagtagtagtttctggcccatcgggagctggaaaaggtact
atatgcaaaaacttcatggagctaaataaacaaatgctcctttcgatttcatctacaact
agaaatccaagagaaaatgaaatagatggagtaaattataattttataacaaagcaggat
tttgaggatttgataggaacagattcccttttggaatatgttcatgtatttggaaactat
tacggaacacctaaaaaatgggtgcttgaatgcatagaaaaaggaaaagatgtgcttctt
gaaatagaaatagtaggggccatgaaagtgaaagaaaagtatccagatgctattttggtt
tttgttctgcctccatcacttaaggagctaaaaaatagaattgtaactagagggacagaa
actattgaacaaatagaaaacagaatggcaagagcaatgcaagaaataaaaacaatagaa
aaatacgactactttatttttaacgacaatttgactagagcagtagatgatcttgaagct
ataataagcgcagaaaaaaacaaagtgaaccgatacagccaggaaattgtcaaaatttat
gaggaggaattataa

DBGET integrated database retrieval system