KEGG   Clostridium sticklandii: CLOST_1978Help
Entry
CLOST_1978        CDS       T01334                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
cst  Clostridium sticklandii
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CLOST_1978
Enzymes [BR:cst01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     CLOST_1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2110655..2111644
Genome map
AA seq 329 aa AA seqDB search
MKMPRKLTIANLPTNIEHLKRLSSELGNVAIYLKRDDQTGTEVSGNKIRKLEFAIAEAID
NGYDTLITCGAVQSNHARATAAAAAKIGLKCHLILRGSSEDVFEGNYFLDGLFGASIDIV
DSEEFKNIDKLLKAKQDELESKGRKGYVLPIGASNGIGGFGYFYAMNEILEQEKTLGIHF
DAIVTTVGSAGTFAGLLYANTLVKNDAVVYGINISADREYFAGETKKIIAEMNEYTGENI
SLSYDEISIIDGYAGRGYGLSTKEEIDFIKYIASLEGVALDPVYTGKAFYGLYNEIKKGN
LSNHKNILFIHTGGIFGWKAEQRDIIKNF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgccaagaaagctaactattgctaatctaccaacaaatatcgaacatttaaaa
agattatcatcagagcttggaaatgtagctatctatcttaagcgtgatgaccaaactgga
actgaggtgtctggaaataaaatcagaaagctggaatttgctatagctgaagctattgat
aacggttatgatactcttatcacctgtggagctgtccagtcaaaccatgccagagctact
gctgcagccgccgcaaagattggtttaaaatgtcacctgattttaagaggaagtagtgaa
gatgtctttgaaggaaattactttttagatggattatttggagcaagtattgatattgtg
gatagcgaagaatttaagaatatagataaactactaaaagcaaagcaagatgagctagag
tctaaaggaagaaaaggctacgtgctccctattggagcatcaaatggtatcggtggtttt
ggatatttttatgccatgaatgaaattctagagcaagaaaaaactctaggtatccacttt
gatgctatagttacaactgtgggttctgctggtacttttgcaggacttctctatgccaac
accctcgtaaaaaatgatgctgtagtctatggtataaatatctcagctgacagagagtat
ttcgctggtgaaactaaaaaaatcatagctgagatgaatgagtatactggagagaatatc
agcctttcttacgatgaaatttctattattgatggatatgccggaagaggttatggactt
agtactaaagaggaaatagattttataaaatacatagctagcttagaaggtgtagctctt
gaccctgtgtatactggcaaagcattttatggtctatataatgaaattaagaaaggaaat
ttatctaatcataaaaatatactctttattcatactggtggaattttcggctggaaagct
gagcaaagagatattataaagaatttctaa

DBGET integrated database retrieval system