KEGG   Clostridium sticklandii: CLOST_1978Help
Entry
CLOST_1978        CDS       T01334                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Organism
cst  Clostridium sticklandii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2110655..2111644
Genome map
AA seq 329 aa AA seqDB search
MKMPRKLTIANLPTNIEHLKRLSSELGNVAIYLKRDDQTGTEVSGNKIRKLEFAIAEAID
NGYDTLITCGAVQSNHARATAAAAAKIGLKCHLILRGSSEDVFEGNYFLDGLFGASIDIV
DSEEFKNIDKLLKAKQDELESKGRKGYVLPIGASNGIGGFGYFYAMNEILEQEKTLGIHF
DAIVTTVGSAGTFAGLLYANTLVKNDAVVYGINISADREYFAGETKKIIAEMNEYTGENI
SLSYDEISIIDGYAGRGYGLSTKEEIDFIKYIASLEGVALDPVYTGKAFYGLYNEIKKGN
LSNHKNILFIHTGGIFGWKAEQRDIIKNF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgccaagaaagctaactattgctaatctaccaacaaatatcgaacatttaaaa
agattatcatcagagcttggaaatgtagctatctatcttaagcgtgatgaccaaactgga
actgaggtgtctggaaataaaatcagaaagctggaatttgctatagctgaagctattgat
aacggttatgatactcttatcacctgtggagctgtccagtcaaaccatgccagagctact
gctgcagccgccgcaaagattggtttaaaatgtcacctgattttaagaggaagtagtgaa
gatgtctttgaaggaaattactttttagatggattatttggagcaagtattgatattgtg
gatagcgaagaatttaagaatatagataaactactaaaagcaaagcaagatgagctagag
tctaaaggaagaaaaggctacgtgctccctattggagcatcaaatggtatcggtggtttt
ggatatttttatgccatgaatgaaattctagagcaagaaaaaactctaggtatccacttt
gatgctatagttacaactgtgggttctgctggtacttttgcaggacttctctatgccaac
accctcgtaaaaaatgatgctgtagtctatggtataaatatctcagctgacagagagtat
ttcgctggtgaaactaaaaaaatcatagctgagatgaatgagtatactggagagaatatc
agcctttcttacgatgaaatttctattattgatggatatgccggaagaggttatggactt
agtactaaagaggaaatagattttataaaatacatagctagcttagaaggtgtagctctt
gaccctgtgtatactggcaaagcattttatggtctatataatgaaattaagaaaggaaat
ttatctaatcataaaaatatactctttattcatactggtggaattttcggctggaaagct
gagcaaagagatattataaagaatttctaa

DBGET integrated database retrieval system