KEGG   Clostridium sticklandii: CLOST_1988Help
Entry
CLOST_1988        CDS       T01334                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cst  Clostridium sticklandii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLOST_1988 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLOST_1988 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLOST_1988 (trpA)
Enzymes [BR:cst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLOST_1988 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2123660..2124430)
Genome map
AA seq 256 aa AA seqDB search
MNNIERVFKNKKAFIPFITCADPNLETTREIIFELVKNGADIIELGIPFSDPTAEGEVIQ
SANTRALLNGVTTDEILDFVQEVKKNLSTVLVFMTYANVIFSYGAEKFIKRCSEIGIEGI
IVPDLPYEEKNEFYPFCKKYEVNLISMIAPTSEDRISMIAKEAEGFLYIVSSMGVTGERT
NITTDLEKIINIAKLNKDIPCAVGFGISTPSQVSKILEIADGVIVGSAIVKIIEKHSINS
AKYVGEFVKQMKSEIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagaaagagtatttaaaaataaaaaggcatttataccatttataacttgt
gcagacccgaatcttgaaactacaagagagataatctttgagctagttaaaaatggagca
gatataatagaacttggaattcctttttctgaccctacagcagaaggggaggttattcaa
tctgcaaatacaagagcgctgctaaatggagtaacgactgatgaaatattagattttgta
caagaggttaaaaagaatctttcgacagtacttgtatttatgacatatgctaatgttata
ttttcatacggggcagaaaagtttataaaaagatgttctgaaataggaattgagggaata
attgtaccagatcttccttacgaagaaaaaaatgaattctatcctttttgtaaaaaatat
gaagttaaccttatttcaatgatagcaccaacttctgaagataggatatcgatgatagcc
aaagaagcagaaggctttttatatatagtttcttccatgggagttactggagaaagaacc
aacataacaactgatttggaaaaaattattaatatagcaaaattaaacaaagatattccg
tgtgcagttgggtttgggatatcaactccatcccaggtgtcaaaaatattagaaattgca
gatggagttattgttggaagtgcaattgttaaaataatagaaaagcattctataaattcg
gccaaatatgtaggagaatttgttaagcaaatgaaatcagagataaaatga

DBGET integrated database retrieval system