KEGG   Clostridium sticklandii: CLOST_2094Help
Entry
CLOST_2094        CDS       T01334                                 

Definition
putative enzyme (EC:3.6.3.-)
Orthology
K16787  
energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
cst  Clostridium sticklandii
Pathway
ABC transporters
Module
Energy-coupling factor transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:cst02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2224001..2224675)
Genome map
AA seq 224 aa AA seqDB search
MIMDNLIEIKNMKYQYHKDKKLFEKFSLQLDCKRTTVITGNNASGKTTLSKLIMGILKPL
EGDIILFGDNSKNMTLSEIGQGIGYVFQYPERQLFTTSVIDELTFAEILKGEKKEAVMEK
AEEMIELFALEKARDVYPFFLSYGEKKRLAIASALMSNPKYLILDEPTASLDKDKIINLS
MILNKLEEKNVGKLIITHDKNFIKEHGERVIHLDGGRIVKDEAN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattatggataatctaattgaaataaaaaatatgaaatatcaatatcataaagataaa
aagctatttgaaaaattttccttgcaattagattgcaaaaggacaacggttatcacaggg
aataatgcttcgggaaagacaaccttgagcaagcttatcatgggaattttaaaaccactt
gaaggagatattattttatttggagacaattcgaaaaacatgactctttctgaaataggt
caaggtataggatatgtctttcaatatccagaaagacagctttttactacttctgtgata
gatgagcttacctttgctgagatcttaaaaggagaaaaaaaggaagcggtgatggaaaag
gcagaagaaatgatagaactatttgctttagaaaaagcaagagacgtttatccatttttt
ttaagctatggagagaaaaaaaggcttgctatagcttcagctttaatgagcaatccaaaa
tatcttattttggacgaacccacagcctctctagataaagataaaattataaacctttct
atgattttaaataagcttgaagaaaaaaatgttggaaaacttatcataactcatgacaaa
aattttataaaagagcacggtgagcgcgtaatccacttggatgggggtcgaattgtaaag
gatgaagcaaattaa

DBGET integrated database retrieval system